SecReT6
Effector Protein ID: 387605702
-
SecReT6 ID485
T6SS typeA1
Gene symbol-
Locus tagEC042_0225
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]263819..264337 [+]
Productputative type VI secretion system protein
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDD3GS60
KEGG IDelo:EC042_0225
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-36, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0034, Aligned region: 93..137
Protein Sequence: 172 a.a.     [Download]
>gi|387605702|ref|YP_006094558.1| putative type VI secretion system protein [Escherichia coli 042]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATIVDMNLHMPHCQDPAQREFTQ
LLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|387605479|ref|NC_017626.1|:263819-264337 Escherichia coli 042, complete genome
ATGCCAACCCCATGTTACATTTCAATTACAGGTCAGACCCAGGGGAACATCACTGCCGGTGCTTTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGACACGAAGATGAAATGCTGGTGCAGGAGTTTCTGCATAA
CGTTACTGTTCCAACCGATCCACAGTCTGGTCAACCTTCCGGGCAGCGCGCGCACAAACCGTTCATTTTC
ACCGTGGCGCTGAACAAAGCCGTTCCGCTGCTGTACAACGCGCTGGCCTCCGGTGAAATGCTGCCGAAAG
TGGAGCTGCACTGGTGGCGTACTTCAGTTGAAGGCAAGCAGGAGCACTACTTCACCACACGTCTTACTGA
CGCGACGATTGTGGACATGAACCTGCACATGCCGCACTGCCAGGACCCTGCACAGCGTGAGTTTACGCAA
TTGCTCGCAGTATCACTGGCATACCGTAAGGTTGAGTGGGAGCACATCAAATCCGGTACTTCTGGTGCCG
ATGACTGGCGTGCACCGCTGGAAGCATAA