SecReT6
Effector Protein ID: 387609950
-
SecReT6 ID463
T6SS typeA2
Gene symbol-
Locus tagEC042_4529
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4858680..4859171 [+]
Productputative type VI secretion protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD3GUW0
KEGG IDelo:EC042_4529
PDB ID4HKH
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|387609950|ref|YP_006098806.1| putative type VI secretion protein [Escherichia coli 042]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKNPAYEKHNHLEQVELRYE
KITWTYKDGNIIHSDAWSERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4858680-4859171 Escherichia coli 042, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGATGATGGCGGTGCAGATATCAAAGGGTCCGTGGATGTTC
AGGACCGTGAGGGCAGCATTGAGGTGGTGGCTCAGGAGCACTGCCTCTACATCCCGACGGATAACAATAC
CGGTAAGCTGACCGGTACCCGTATTCACACGCCGTTTCTGTTTACCAAGGAAATTGATTCTTCCAGCCCG
TACCTTTACAAGGCCGTGACCACCGGGCAGACCCTGAAGTCTGCTGAGTTTAAGTGGTACAAAATCAATG
ATGCCGGTCAGGAGGTGGAGTATTTCAATACGAAGCTTGAGAACGTGAAGGTGGTGAAGGTTAACCCGGT
CATGCACGACATCAAGAATCCCGCTTACGAGAAGCATAACCACCTTGAGCAGGTGGAACTGCGCTACGAG
AAAATCACCTGGACTTACAAGGACGGCAACATCATTCATTCCGACGCATGGAGTGAGCGTACCACCGCGT
AA

Reference
(1) Dudley EG et al. (2006). Proteomic and microarray characterization of the AggR regulon identifies a pheU pathogenicity island in enteroaggregative Escherichia coli. Mol Microbiol. 61(5):1267-82. [PudMed:16925558] experimental
 
experimental experimental literature