SecReT6
Effector Protein ID: 387609980
-
SecReT6 ID464
T6SS typeA4b
Gene symbol-
Locus tagEC042_4564
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4895043..4895549 [+]
Productputative type VI secretion protein
Effector typeProtein
Homologous effectorEC042_4564 (AaiC)
DescriptionAaiC protein
UniProt IDD3GUZ1
KEGG IDelo:EC042_4564
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 168 a.a.     [Download]
>gi|387609980|ref|YP_006098836.1| putative type VI secretion protein [Escherichia coli 042]
MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHI
QDLLENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSI
EMNIPSDDGKSTEKLGPMTYNLYKEALV
-
Nucleotide Sequence: 507 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4895043-4895549 Escherichia coli 042, complete genome
ATGGTCGGAGTTATGAGTAATTCTTCTGCTCTTAGCAGGGAGTTTGTCAAAATAGAGATAGGTGGAAAAG
TTATAAAGGGAAATTCAAAAGTTGAAAACAGTGGTGACTACTTTGATGGACATTGTCCTCAGGCATTTCA
CGCTTTTTCAGGAATTGACGGTACTGTTTTTGATTTAATTAATTTGAAGCTTAGGGTTACTAAACACATA
CAAGACCTTCTGGAGAACTTTTTTAAGAGAGGTGAAAAAGAAGTTAAAATAGAAATTTTACGTAGGGAAT
CAACTAAATCAGGTAGTGCATACTCATCATTTAAGGTTGTTTATCAGGGGTGTCGTATGCATAATATGTT
GTTGGCTCATGATAATGATTCAAATCTCATTCTGGAATTGTCGTTTACCCCAGAAGAGAGTGTCTCAATT
GAGATGAATATTCCGTCAGATGATGGAAAAAGTACGGAGAAATTGGGACCAATGACGTACAACTTATATA
AAGAGGCTCTTGTATAA

Reference
(1) Dudley EG et al. (2006). Proteomic and microarray characterization of the AggR regulon identifies a pheU pathogenicity island in enteroaggregative Escherichia coli. Mol Microbiol. 61(5):1267-82. [PudMed:16925558] experimental
 
experimental experimental literature