SecReT6
Effector Protein ID: 387824964
-
SecReT6 ID773
T6SS typeB
Gene symbol-
Locus tagFN3523_1381
StrainFrancisella cf. novicida 3523
Repliconchromosome [GenBank: NC_017449] [Browse all T6SS(s) in this replicon]
Location [Strand]1416469..1417629 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTL_0118
DescriptionIglI protein
UniProt IDF4BGU0
KEGG IDfcn:FN3523_1381
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 386 a.a.     [Download]
>gi|387824964|ref|YP_005824435.1| hypothetical protein FN3523_1381 [Francisella cf. novicida 3523]
MSELISTLNSIELVTQDKINLIANMQIHAKYENAEYKSFIDQLIDNINVNKSIDIYSLFLSLNSEICLNL
CEIDNIAEIISSYLSILNTNFTKISPSESKQKDELAEKGINKFLVTMDINFAEMKNQNNLSLNNIELLIK
LIEQITIFFENNNLNYNPDLKIQLNKTLKKIKDSLILEDQKSHESKVKETINETKKKEQASITDKKTIQG
SEKWITLIEKIEVLKALVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDY
YSSSIQWSIAQKMYNIDYKSFLDNLEKMPENNFLNSSPDITKNFFYETSSELKKTPIQDHKIMAEADAIK
KEIEIKQHPNVKKNQNNGEKISSEIDEEYFEDLFDI
-
Nucleotide Sequence: 1161 bp     [Download]
>gi|387823583|ref|NC_017449.1|:1416469-1417629 Francisella cf. novicida 3523 chromosome, complete genome
ATGAGTGAGCTAATATCTACATTAAACAGTATTGAGTTAGTAACTCAAGATAAGATAAATCTTATTGCTA
ACATGCAAATCCACGCAAAATATGAAAATGCTGAGTATAAATCATTTATTGATCAATTAATAGATAATAT
TAACGTTAATAAAAGCATAGATATATATAGTTTATTTCTATCTTTAAATTCAGAAATATGCCTTAATTTA
TGTGAGATTGATAACATCGCTGAAATTATTAGCTCTTATTTATCTATTCTAAATACCAATTTCACAAAAA
TTAGTCCATCAGAATCAAAACAAAAAGACGAGTTGGCTGAAAAAGGGATAAATAAATTCTTAGTTACTAT
GGATATAAATTTTGCAGAAATGAAAAATCAAAATAACTTATCATTAAATAACATAGAATTACTTATAAAA
CTTATAGAGCAAATAACAATATTTTTTGAGAATAATAATTTAAATTATAATCCTGATTTAAAAATCCAGC
TAAACAAGACTCTTAAAAAAATAAAGGATTCTTTGATTTTAGAAGATCAAAAAAGTCATGAGTCTAAAGT
TAAAGAAACAATAAATGAAACAAAAAAGAAAGAACAAGCGAGTATTACAGATAAAAAAACCATACAAGGT
TCTGAAAAATGGATAACCCTCATTGAAAAGATTGAAGTTTTAAAAGCTTTAGTTGAAAGTGAAAGGATAT
TTGAAACTTCTATTGTTTATAATGATATCCAAAATTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCC
TGAAATTTTCTTCCCATTATACAAGAAAATAGCTCCTTTTATTGGCAATATCCATAAAAACATAGACTAC
TACTCATCAAGTATCCAATGGAGCATAGCTCAAAAAATGTACAACATAGATTACAAGAGTTTTTTAGATA
ATCTTGAAAAAATGCCAGAAAATAATTTTTTAAATTCTTCTCCTGATATAACTAAAAATTTCTTTTATGA
AACATCTTCTGAACTAAAAAAAACCCCTATACAAGATCATAAAATAATGGCTGAAGCAGATGCCATCAAA
AAAGAAATAGAAATAAAACAGCATCCTAATGTTAAAAAAAATCAAAATAATGGAGAAAAAATTTCAAGTG
AGATAGATGAAGAATATTTTGAAGATCTTTTTGACATATAA