SecReT6
Effector Protein ID: 387830663
-
SecReT6 ID490
T6SS typeA2
Gene symbol-
Locus tagECSF_2610
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2842624..2843115 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD2NLX6
KEGG IDese:ECSF_2610
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|387830663|ref|YP_003350600.1| hypothetical protein ECSF_2610 [Escherichia coli SE15]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKDPSREKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2842624-2843115 Escherichia coli SE15, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCCTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGCCAGACTCTGAAAACGGCAGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTTGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
TATGCACGACATCAAGGATCCTTCCAGAGAGAAGCATAACCACCTGGAACGTATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA