SecReT6
Effector Protein ID: 387868326
evpP
SecReT6 ID597
T6SS typeA4b
Gene symbolevpP
Locus tagETAF_2198
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2505588..2505890 [+]
Producttype VI secretion system protein EvpP
Effector typeProtein
Homologous effectorEvpP
Description
UniProt IDE0T3W7
KEGG IDetd:ETAF_2198
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 100 a.a.     [Download]
>gi|387868326|ref|YP_005699795.1| type VI secretion system protein EvpP [Edwardsiella tarda FL6-60]
MLIAKQNGVSMREWGRLTSVIKENWSSLDFLLEIVLKIPVYAWFGGFKGMSRIDNGMTSKRNITLEQKGR
SSMLPGGATQFYIPNLTVGHISSHQFSILK
-
Nucleotide Sequence: 303 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2505588-2505890 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGCTGATCGCTAAGCAAAACGGGGTATCAATGAGGGAATGGGGACGACTCACCTCCGTGATCAAAGAAA
ACTGGAGCTCTCTCGACTTTTTACTTGAGATAGTCCTAAAGATTCCCGTCTATGCCTGGTTCGGTGGATT
TAAGGGCATGTCGCGCATTGATAATGGTATGACCTCTAAACGAAATATCACGCTGGAACAAAAAGGCCGG
AGCTCAATGCTCCCCGGCGGGGCCACACAGTTCTATATTCCAAACCTGACGGTCGGGCATATCAGTAGCC
ACCAATTTTCAATATTGAAATAG