SecReT6
Effector Protein ID: 387868329
evpC
SecReT6 ID597
T6SS typeA4b
Gene symbolevpC
Locus tagETAF_2201
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2508209..2508700 [+]
Producttype VI secretion system protein EvpC
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDE0T3X0
KEGG IDetd:ETAF_2201
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-35, Aligned region: 6..137
Protein Sequence: 163 a.a.     [Download]
>gi|387868329|ref|YP_005699798.1| type VI secretion system protein EvpC [Edwardsiella tarda FL6-60]
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVTKWMDCASVKL
ASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSDRPQETIDFAYKEVTWEYVPQ
DQNGKAGGKIGPEGWSLITNKKK
-
Nucleotide Sequence: 492 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2508209-2508700 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGGCTTTTGATACTTATATCAAACTGGATAAGGTTGATGGGGAATCCACCGACGATAAGCACAAAAAAT
GGATTGAAGTGCTGGGTTTTGCCTGGGGAGCCGGCAATGAATGCACGATGGAGAGCGGCACCCAGGGGCT
GAATACCGGTAAGGCGATGATGTCGGTGCTGCGTGTCACCAAATGGATGGACTGCGCCAGTGTCAAGCTG
GCCTCCGCCGCCGTGCAGGGGCAGAACTTTCCCACGCTGGAGCTGGAGATTTGCACCCAGGCGGGCGATA
AGTTCGCCTTCTGCATCTACAAATTTACGCATGTCGCCGTCTCCAGCTATCAATGCTCAGGGGCCACGGG
CGGCAGCGATCGCCCGCAGGAAACCATTGATTTCGCTTATAAAGAAGTGACCTGGGAATACGTTCCCCAG
GATCAGAACGGCAAGGCGGGCGGCAAAATTGGTCCTGAGGGCTGGAGCCTGATTACCAACAAGAAAAAGT
AA