SecReT6
Effector Protein ID: 387896392
hcp1
SecReT6 ID657
T6SS typeA3
Gene symbolhcp1
Locus tagPflA506_5303
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5805855..5806343 [+]
Producttype VI secretion system effector Hcp1
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDI2BNU1
KEGG IDpfc:PflA506_5303
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|387896392|ref|YP_006326689.1| type VI secretion system effector Hcp1 [Pseudomonas fluorescens A506]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGGGGGAGKVNIQDLSLTKYVDKASPNLM
MHCASGKHIDKVKLTVRKAGGESQVEYMVINLEEVLVTSLSTGGSGSDDRLTENVTLNFAQVMVDYQPQK
ADGTKDGGAIKFGWNIRSNTKR
-
Nucleotide Sequence: 489 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5805855-5806343 Pseudomonas fluorescens A506 chromosome, complete genome
ATGGCTGTTGATATTTTCATCAAGATCGGCGACATCAAGGGCGAGTCCATGGACAAGGCCCACAAGGACG
AAATCGATGTGTTGAACTGGAGCTGGGGCATGTCCCAGTCCGGCAACATGCACGTCGGCGGTGGCGGTGG
CGCGGGCAAGGTGAATATCCAGGACCTGTCGCTGACCAAGTACGTCGACAAGGCTTCGCCCAACCTGATG
ATGCACTGCGCCAGCGGCAAGCACATCGACAAGGTCAAGCTGACCGTGCGCAAGGCCGGTGGCGAGAGCC
AGGTCGAGTACATGGTGATCAACCTGGAAGAAGTGCTGGTCACCTCCTTGAGCACCGGCGGTTCGGGCAG
CGATGATCGCCTGACCGAAAACGTCACCCTGAACTTCGCCCAAGTGATGGTCGACTACCAGCCGCAGAAA
GCCGACGGCACCAAAGACGGCGGCGCCATCAAGTTTGGCTGGAACATTCGCTCCAACACCAAACGCTGA