SecReT6
Effector Protein ID: 387896397
vgrG1
SecReT6 ID657
T6SS typeA3
Gene symbolvgrG1
Locus tagPflA506_5308
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5812604..5814550 [+]
Producttype VI secretion protein VgrG1
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDI2BP30
KEGG IDpfc:PflA506_5308
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-87, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.20E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 514..536
Gp5_C [PF06715], Evalue: 0.0034, Aligned region: 542..556
Protein Sequence: 648 a.a.     [Download]
>gi|387896397|ref|YP_006326694.1| type VI secretion protein VgrG1 [Pseudomonas fluorescens A506]
MLFNQASRLAKINSPLGPDVLLLNEMGGGEELGRLFNYELQLTSLDANIDLNQLLGKPMSVGLQLADGGE
RHFHGIVARCSQNIDKGQFASYQVTLRPWLWLLSRTSDCRIFQNLSIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQDRHVLVLADAYGAHTSVPGYASIPYYPKDEQQRER
DHMHNWHLAQEVQPGSLELNDYDFQRPSASIDVRSAMPRPHTAGDYPLYDYPGTYVQSADGEHYARTRIE
ALQTLHEQIEFSGNARGLGSGHLFSLTGFSRQDQNREYLIVGCRYFIVQESLESGGGSGSAQFESSLTCI
DAQQSFRPLANTHRPIVKGPQTALVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQSWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPENATQSGMKSRSSKGGTPANFNEIRM
EDKKGLEQLYIHAERNQDIVVEVDESHSVGHDRNKNIGHNETVTIGSNRLRVVRNNDTVIVGGAKSDSAA
TSYTIEAGESLRLVCGDSVIELKAGGDINLTCGSFNLFSTGSSKIQTKGKLDINLGSDKGTSPGAQGVQS
TIKSAVESKFPGKPGAGQ
-
Nucleotide Sequence: 1947 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5812604-5814550 Pseudomonas fluorescens A506 chromosome, complete genome
ATGCTATTCAACCAAGCCTCACGCCTGGCCAAGATCAACAGCCCCCTCGGGCCGGATGTGCTGCTGCTCA
ACGAAATGGGCGGCGGTGAAGAGTTGGGCCGGCTGTTCAACTATGAGCTGCAACTGACGTCCCTGGACGC
CAACATCGACCTGAACCAATTGCTGGGTAAACCGATGAGCGTCGGCCTGCAACTGGCGGACGGCGGCGAG
CGGCATTTCCACGGGATCGTTGCGCGGTGCAGCCAGAACATCGACAAAGGCCAGTTCGCCAGTTACCAAG
TCACCCTGCGCCCTTGGCTGTGGTTGCTCAGCCGCACCTCCGACTGCCGGATTTTCCAGAACCTGAGCAT
CCCGCAGATCATCAAGCAGGTGTTCCGTGACCTGGGTTTTTCCGACTTTGAAGACGCCCTCAGCCGGCCG
TATCGCGAGTGGGAGTACTGCGTGCAGTACCGCGAGACCAGCTTCGATTTCGTCAGCCGACTGATGGAAC
AGGAAGGCATCTACTACTTCTTCCGCCATGAACAGGACCGCCATGTGCTGGTGCTGGCCGACGCCTATGG
CGCCCACACCAGCGTGCCCGGCTACGCGTCGATCCCCTACTACCCCAAGGACGAGCAGCAGCGCGAACGC
GACCATATGCACAATTGGCACCTGGCGCAGGAGGTGCAGCCGGGCTCGCTGGAGCTGAACGACTACGACT
TCCAGCGCCCCAGCGCGAGCATCGACGTGCGCTCGGCCATGCCGCGCCCGCACACCGCCGGCGACTACCC
GCTGTACGACTACCCCGGTACCTACGTGCAAAGCGCCGACGGCGAACACTATGCGCGCACCCGCATCGAG
GCCCTGCAAACCCTGCATGAACAGATCGAGTTCAGCGGCAATGCGCGCGGGCTGGGCTCGGGCCATCTGT
TCAGCCTCACCGGTTTCAGTCGCCAGGACCAGAACCGCGAGTACCTGATCGTCGGTTGCCGCTACTTCAT
CGTGCAAGAAAGCCTGGAAAGCGGTGGCGGTTCAGGCTCGGCGCAGTTTGAAAGCAGCCTGACCTGCATC
GACGCCCAACAGAGTTTCCGCCCGCTGGCCAATACTCACCGCCCCATCGTCAAAGGCCCGCAGACCGCCT
TGGTGGTAGGCCCCAAGGGCGAGGAAATCTGGACCGACCAGTACGGCCGCGTGAAGGTGCACTTCTACTG
GGACCGCCACGACCAATCCAACGAGAACAGCTCGTGCTGGATTCGTGTGTCGCAATCCTGGGCCGGCAAG
AACTGGGGCTCGATGCAGATTCCGCGCATCGGCCAAGAGGTGATCGTCAGCTTCCTCGAAGGCGACCCCG
ACCGACCGATCATCACCGGGCGGGTCTACAACGCTGAGCAGACGGTGCCCTACGACTTGCCGGAGAACGC
CACCCAGAGCGGCATGAAAAGTCGCTCCAGCAAAGGCGGCACGCCGGCCAACTTCAATGAAATCCGCATG
GAGGACAAGAAGGGCTTGGAGCAGTTGTATATCCATGCCGAGCGTAACCAGGACATCGTGGTGGAGGTGG
ATGAAAGCCACTCGGTGGGGCATGACCGCAACAAGAATATTGGGCATAACGAGACGGTGACCATTGGCAG
TAACCGCCTGCGGGTTGTGCGCAATAACGACACGGTGATCGTGGGCGGTGCCAAGTCCGACAGCGCCGCC
ACGAGTTACACCATCGAGGCCGGCGAGAGTCTTCGCCTGGTGTGCGGCGACAGCGTGATTGAGCTCAAGG
CTGGCGGCGACATCAACCTGACCTGTGGCTCGTTCAACCTGTTTTCCACCGGCAGCAGCAAGATCCAGAC
GAAGGGCAAGCTGGACATCAACCTGGGCAGCGACAAAGGCACTTCGCCGGGTGCCCAGGGCGTGCAAAGC
ACGATCAAGTCCGCCGTCGAGTCAAAATTCCCCGGTAAGCCCGGTGCTGGTCAATAA