SecReT6
Effector Protein ID: 389841193
hcp1
SecReT6 ID662
T6SS typeA2
Gene symbolhcp1
Locus tagES15_2193
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2338646..2339137 [-]
ProductType VI secretion system effector, Hcp1 family 1
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDI2EJB4
KEGG IDcsk:ES15_2193
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|389841193|ref|YP_006343277.1| Type VI secretion system effector, Hcp1 family 1 [Cronobacter sakazakii ES15]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHSLYIPTDNNTGKLTGTRIHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPLMHDIKEPSKEKHNHLERIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2339137-2338646 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGCAATTCCTGTTTATCTCTGGCTGAAGGACGACGGTGGCGCGGACATCAAGGGTTCCGTTGATGTGA
AGGACCGCGAGGGCAGCATCGAGGTGGTGGCGCAGGAGCACTCGCTGTACATCCCGACCGACAACAACAC
CGGCAAGCTGACCGGCACCCGTATCCACACGCCGTTCCTGTTCACCAAGGAAATCGACGCCTCCAGCCCG
TATCTGTACAAGGCGGTGACCACCGGCCAGACCCTGAAGTCGGCGGAATTTAAATGGTACCGCATCAACG
ACGCGGGCCAGGAGGTGGAGTATTTCAACACGAAGCTTGAGAACGTGAAGCTGGTGAAAGTGGCACCGCT
GATGCACGACATCAAGGAGCCCTCGAAGGAAAAGCATAACCATCTTGAGCGCATCGAGCTGCGCTACGAA
AAAATCACCTGGACCTACAAGGACGGCAACATCATCCATTCCGATTCGTGGAACGAACGTACCACTGCCT
GA