SecReT6
Effector Protein ID: 392977332
-
SecReT6 ID673
T6SS typeA3
Gene symbol-
Locus tagA3UG_02355
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]504315..504800 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDI6S9G8
KEGG IDenl:A3UG_02355
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.20E-34, Aligned region: 6..146
Protein Sequence: 161 a.a.     [Download]
>gi|392977332|ref|YP_006475920.1| type VI secretion system effector [Enterobacter cloacae subsp. dissolvens SDM]
MAIPAYLWLKDDGGALIKGAVDVQDRESSIEVNGFSHNVSIPTDPLTGKITGTRKHSSILFMKEFDCSSP
YLFKAVCSGQTLISAEFKWYRINDAGQEVEYNNMFLENVKIVGVSPVMHDTKDASKEKHNHLECVEMRYE
KITWKHCDGNLLFSDSWNERA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|392976867|ref|NC_018079.1|:504315-504800 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGGCTATTCCTGCTTATTTATGGCTGAAGGATGACGGTGGTGCGTTAATAAAAGGTGCTGTTGACGTAC
AAGATAGAGAGTCAAGTATAGAGGTAAATGGGTTTTCACATAATGTATCTATTCCAACAGATCCATTGAC
AGGAAAAATTACCGGAACAAGGAAGCACTCAAGTATCCTCTTTATGAAAGAATTTGATTGTTCATCTCCC
TATCTGTTCAAGGCGGTTTGTAGCGGTCAAACGTTAATAAGCGCAGAGTTTAAATGGTATCGTATTAACG
ATGCGGGTCAGGAAGTTGAGTATAACAACATGTTTCTTGAAAACGTAAAAATTGTCGGTGTTTCGCCTGT
CATGCATGATACGAAAGATGCTTCGAAAGAGAAACATAATCACCTTGAATGTGTTGAGATGCGATATGAA
AAAATAACATGGAAACACTGTGATGGGAATTTGCTCTTTTCCGATAGCTGGAACGAAAGGGCATAA