SecReT6
Effector Protein ID: 392978007
-
SecReT6 ID673
T6SS typeA3
Gene symbol-
Locus tagA3UG_05760
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]1263573..1267769 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorECL_03140
DescriptionrhsB
UniProt IDI6SBF9
KEGG IDenl:A3UG_05760
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 404..435
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 478..492
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 509..529
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 549..586
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 596..614
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 636..672
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 657..693
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 699..732
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 720..756
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 741..775
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 762..790
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 813..844
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 865..897
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 927..953
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 977..1006
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 1014..1028
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 1051..1088
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 1071..1109
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 1130..1141
RHS_repeat [PF05593], Evalue: 2.30E-46, Aligned region: 1170..1185
RHS [PF03527], Evalue: 1.80E-15, Aligned region: 547..560
RHS [PF03527], Evalue: 1.80E-15, Aligned region: 589..603
RHS [PF03527], Evalue: 1.80E-15, Aligned region: 723..750
RHS [PF03527], Evalue: 1.80E-15, Aligned region: 1044..1061
RHS [PF03527], Evalue: 1.80E-15, Aligned region: 1162..1199
PAAR_motif [PF05488], Evalue: 1.20E-13, Aligned region: 4..15
PAAR_motif [PF05488], Evalue: 1.20E-13, Aligned region: 26..49
PAAR_motif [PF05488], Evalue: 1.20E-13, Aligned region: 85..155
WHH [PF14414], Evalue: 8.20E-13, Aligned region: 1326..1368
Colicin-DNase [PF12639], Evalue: 0.0007, Aligned region: 87..125
Colicin-DNase [PF12639], Evalue: 0.0007, Aligned region: 1324..1360
DUF4150 [PF13665], Evalue: 0.002, Aligned region: 88..114
DUF4150 [PF13665], Evalue: 0.002, Aligned region: 121..155
DUF4150 [PF13665], Evalue: 0.002, Aligned region: 150..166
Protein Sequence: 1398 a.a.     [Download]
>gi|392978007|ref|YP_006476595.1| Rhs family protein [Enterobacter cloacae subsp. dissolvens SDM]
MFEAARVGDDIGHSGALAGMIAGTIVGGLIAAAGGILAGAMFIAGLGASCLGVGVLLVGASLAVGYYTGE
LATAARDSIADAGASSMTKKGVITSGSPNVFINSKPAAIATDSAVKCSDDGSQQMAEGSKRVSINSQPAS
RIGDRTTCDAKVMTGSDNVFIGGDPQQTLPIQSEVPEWLYKVSDLTLLFAGLLGGWGGAAGKVGALSKLL
GKIPGINKLARIACRAGTLMTGVAAAGIIARPVDIVSGQKFLSGDDELDFVLPSRLPVRWQRYWRSGNPG
DSVLGRGWSLFWESRLEPYQDGLVWRAPSGDYVAFPNVPKGMRTYCESEKNWLERHHDDSWSVYDVSGER
WHYAPLQDDAPSLLQRISEPCGNDILFEWNADNTLHALTDSAGQRVVCRYDRDRLTGAWLDDEICLVSYA
YDEQRQLVCVTGRGGSVRRRFSWQDGLMSAHEDANGLLSEYRWREIDGLPRVVGFRHSGGEQLTFEYDFD
NGTRRATREDGAQAHWLVDDDDNVARFTDYDGRQTTFVYRDGELSDVILPGGAMRCSTWDKYGRMTSETD
PAGRRTEYYWYRLTDRITRTVYPDGTSSQAMYDLCGRLLSETDPAGNATAYHYPDEEENLPESITDAIGG
VVRLVWNHQGLLMQRTDCSGSVTRFTYDRFGQLIASEDAEGNITRREWNNAGLLSAVIHPDGSRESLVWN
ERGQLTGWRDPLESEVRWAYNALGLPVSLTDRIGRVRQWRYDPRGNLLRLDNGNGAEYRFTYDAVGRPLS
ETRPDETVRHMEWDARGLLCALEENGRPAADGGIARRVQQFSYDDSGLLIGRTQRHAEYRYVRDLSGQIT
HIRRTPTAEGVALGIESDEIAYRHDAAGRVLSESGINGAVGYEWDALSNLTGLTLPGEQKLAWLHYGSGH
VSAIRFGQQLVTEFTRDRLHREVRRTQGAREQLRQYDSLGRRTLQRSELSTEVTLPEQAIRERLYRYTAR
GELSGVSDTLRGEVDYGYDAEGRLLKHYEARQGHSRAQFSYDAADNLAANDDAVPVTDNRLQHWQALFMK
YDHWGNLVSRRNGLYEQHYAYDAENRLVSARGTGPEGRFEARYHYDALGRRTSKIVTTAHGTTETRFLWQ
GYRLLQEQQQTGLCSTYIYDPNEAWSPLARVDHLRDQKSGEIYWFNTDLNGAPLEVTDERGAVRWSGQYG
SFGEVRHQSEGFSRVVNRTAMAHQPLRYAGQYADGETGLHYNLFRYYDPQVGRFIVQDPIGLAGGNLNLY
NYAPNPLLWIDPMGLALSGVDFSGSPSLYPVTGTQRNIVEITLQGSRGRDFTEAYKLAGISEADASEYTW
HHLDDFDPKTGKSTMQLVTTEAHKASFPHKGSVSQFEKHFGVKYGSPEAIKISHSKGWLRGRIPKHCQ
-
Nucleotide Sequence: 4197 bp     [Download]
>gi|392976867|ref|NC_018079.1|:1263573-1267769 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGTTTGAAGCTGCACGCGTTGGTGATGATATCGGCCACTCCGGTGCGCTGGCCGGGATGATTGCCGGAA
CGATTGTCGGTGGCCTGATTGCCGCCGCCGGGGGCATTCTGGCGGGGGCGATGTTTATTGCCGGTCTCGG
CGCATCCTGCCTTGGCGTGGGTGTGCTGCTCGTCGGCGCCAGCCTGGCCGTGGGGTATTACACCGGGGAG
CTGGCGACCGCCGCCCGGGACAGTATCGCCGACGCCGGGGCATCCAGTATGACGAAGAAAGGCGTCATCA
CCTCCGGCTCGCCCAATGTGTTTATCAACAGCAAACCCGCCGCCATCGCGACGGACAGCGCGGTGAAGTG
CTCGGACGACGGCTCGCAGCAGATGGCCGAAGGCTCTAAGCGCGTCTCGATTAACAGCCAGCCGGCGTCC
CGCATCGGGGATCGCACCACCTGCGACGCGAAGGTGATGACCGGCTCGGACAACGTCTTCATCGGCGGCG
ATCCGCAGCAAACCCTGCCCATTCAGTCTGAAGTGCCCGAGTGGCTCTATAAAGTCTCCGATCTTACCCT
GCTGTTCGCCGGGCTTCTCGGCGGCTGGGGCGGTGCGGCCGGCAAAGTCGGGGCGCTCTCTAAGCTGCTG
GGCAAAATCCCTGGGATCAATAAGCTGGCCCGTATCGCCTGCCGCGCCGGCACGCTGATGACCGGCGTAG
CGGCCGCGGGGATCATCGCCCGTCCGGTGGATATCGTCAGCGGACAGAAGTTTCTCAGCGGGGATGATGA
GCTCGATTTCGTTCTGCCGTCACGCCTGCCGGTGCGCTGGCAGCGCTACTGGCGCAGCGGCAACCCCGGC
GACAGCGTGTTGGGCCGCGGCTGGAGCCTGTTCTGGGAAAGCCGCCTGGAGCCCTATCAGGACGGGCTGG
TGTGGCGTGCGCCGTCCGGCGATTACGTTGCCTTCCCGAACGTGCCGAAAGGGATGCGCACCTACTGCGA
GAGCGAAAAAAACTGGCTTGAACGTCACCATGACGACAGCTGGTCGGTGTATGACGTCAGCGGCGAGCGC
TGGCACTATGCGCCGCTGCAGGATGACGCACCGTCACTGCTTCAGCGCATCTCAGAACCCTGCGGCAACG
ATATTCTCTTCGAGTGGAATGCGGATAATACTCTGCATGCCCTGACCGACAGCGCGGGCCAGCGCGTGGT
CTGCCGCTACGACCGCGACAGGCTCACCGGCGCCTGGCTGGATGACGAGATCTGCCTGGTCAGTTACGCT
TATGATGAACAGCGCCAGCTGGTCTGCGTGACCGGCCGGGGCGGTAGCGTGCGCCGACGCTTCAGCTGGC
AGGACGGGCTGATGAGCGCCCACGAGGACGCCAACGGCCTGCTGAGCGAATACCGCTGGCGGGAGATTGA
CGGCCTGCCGCGTGTGGTCGGTTTTCGCCACAGCGGCGGCGAACAGCTGACGTTCGAATACGATTTTGAT
AACGGCACCCGCCGCGCGACCCGCGAAGACGGCGCGCAGGCGCACTGGCTGGTGGATGACGACGACAACG
TCGCGCGCTTCACGGATTACGACGGCCGCCAGACGACGTTTGTCTACCGCGACGGCGAGCTCAGCGATGT
CATTCTGCCCGGCGGTGCGATGCGCTGCAGTACCTGGGATAAGTATGGCCGCATGACCAGTGAGACGGAC
CCGGCAGGCCGTCGCACAGAATATTACTGGTATCGTCTGACCGACCGCATCACCCGCACGGTGTACCCAG
ACGGTACCTCATCGCAGGCCATGTACGACCTTTGCGGTCGTCTGCTGTCGGAAACGGATCCGGCCGGTAA
CGCCACCGCGTATCACTATCCCGATGAGGAAGAAAACCTGCCGGAGAGCATTACCGACGCCATCGGCGGT
GTGGTGCGCCTGGTCTGGAACCACCAGGGGCTGCTGATGCAGCGCACCGATTGCTCCGGCAGCGTGACCC
GCTTCACCTACGACCGCTTCGGGCAGTTGATTGCCAGCGAGGATGCGGAAGGGAATATCACGCGTCGGGA
GTGGAACAACGCCGGGCTGCTGAGTGCCGTGATCCATCCGGACGGCAGCCGCGAGTCGCTGGTGTGGAAC
GAACGCGGCCAGCTCACGGGCTGGCGCGACCCGCTGGAAAGCGAGGTGCGCTGGGCCTATAACGCGCTCG
GCCTCCCGGTCAGCCTCACCGATCGTATTGGCCGCGTGCGCCAGTGGCGCTACGACCCACGCGGTAACCT
GCTGCGCCTTGATAACGGCAACGGGGCGGAATATCGCTTTACCTACGACGCCGTGGGCCGCCCGCTCAGC
GAAACGCGTCCTGACGAGACCGTACGCCATATGGAATGGGATGCGCGAGGGCTCCTCTGCGCGCTCGAAG
AAAACGGCCGACCTGCCGCCGACGGCGGTATTGCCCGCCGCGTCCAGCAGTTCAGCTATGACGACAGCGG
GCTGCTGATCGGGCGCACTCAGCGCCACGCGGAGTACCGCTACGTCCGCGACCTGAGCGGCCAGATCACC
CACATCCGCCGCACGCCAACCGCCGAAGGCGTTGCCCTGGGTATCGAAAGCGATGAGATTGCTTACCGCC
ACGATGCCGCCGGGCGCGTGCTGAGCGAATCCGGCATTAACGGCGCGGTGGGCTATGAATGGGATGCCCT
GAGTAACCTGACCGGCCTGACGCTGCCCGGCGAGCAAAAGCTGGCCTGGCTGCACTATGGCTCCGGCCAT
GTCAGTGCCATCCGCTTTGGGCAGCAGCTGGTGACCGAGTTCACCCGCGACCGCCTGCACCGCGAGGTCC
GCCGCACCCAGGGCGCGCGCGAGCAGCTCCGTCAGTATGACAGCCTTGGCAGACGTACCCTGCAGCGCAG
TGAGCTGAGTACGGAGGTGACCCTGCCGGAGCAGGCGATACGGGAACGCCTGTATCGCTACACCGCACGC
GGTGAGCTTTCTGGTGTCAGCGACACCCTGCGCGGTGAGGTGGATTACGGCTACGACGCCGAAGGGCGTC
TGCTGAAGCACTACGAGGCCCGACAGGGGCACAGCCGCGCGCAGTTCAGCTATGACGCCGCGGATAACCT
CGCCGCCAATGATGATGCGGTACCGGTCACGGATAACCGCCTGCAGCACTGGCAGGCGCTGTTTATGAAA
TACGACCACTGGGGCAACCTGGTCAGCCGCCGCAACGGACTGTATGAACAGCATTATGCGTATGACGCCG
AGAACCGGCTGGTATCTGCCCGCGGAACCGGGCCGGAAGGGCGGTTTGAGGCGCGCTATCACTACGACGC
GCTGGGCCGCCGTACCAGCAAAATCGTCACCACCGCGCACGGCACCACCGAAACGCGCTTCCTGTGGCAG
GGCTACCGCCTGTTGCAGGAGCAGCAGCAAACCGGGCTGTGCAGTACATATATTTATGACCCGAATGAAG
CCTGGAGCCCACTGGCGCGGGTGGATCACCTTCGTGACCAGAAGAGCGGTGAGATTTACTGGTTCAATAC
CGACCTGAACGGCGCGCCGCTGGAGGTGACCGACGAGCGTGGTGCGGTACGCTGGAGCGGCCAGTACGGC
AGCTTTGGCGAGGTACGCCATCAGAGCGAAGGGTTCTCACGGGTTGTGAATCGCACAGCGATGGCACATC
AACCGCTTCGCTATGCCGGGCAGTACGCTGACGGTGAAACGGGGCTGCATTATAACCTGTTCCGCTACTA
CGACCCGCAGGTCGGGCGGTTTATTGTGCAGGATCCGATTGGGTTAGCTGGTGGAAACTTAAATTTATAT
AACTATGCCCCTAATCCTCTGTTATGGATAGACCCTATGGGTCTGGCATTGAGCGGCGTTGACTTTAGTG
GAAGCCCATCACTTTATCCTGTTACTGGGACACAACGAAATATCGTTGAAATTACCCTTCAAGGATCAAG
GGGGCGGGATTTCACAGAAGCCTACAAACTTGCAGGCATAAGTGAAGCTGATGCAAGCGAATATACATGG
CATCATCTTGACGATTTTGATCCAAAAACAGGTAAGTCAACTATGCAGTTGGTCACGACTGAGGCGCACA
AAGCATCTTTCCCACATAAGGGGTCTGTATCTCAGTTCGAAAAACATTTTGGAGTGAAGTATGGCTCTCC
TGAAGCTATAAAAATATCTCATAGTAAAGGATGGCTGAGAGGTCGTATTCCTAAACATTGTCAATAG