SecReT6
Effector Protein ID: 392979167
-
SecReT6 ID673
T6SS typeA3
Gene symbol-
Locus tagA3UG_11605
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2512938..2513420 [+]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDI6SEJ8
KEGG IDenl:A3UG_11605
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-37, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|392979167|ref|YP_006477755.1| Hcp family type VI secretion system effector [Enterobacter cloacae subsp. dissolvens SDM]
MAIPVYLWIRDDGNTEIKGSVDVQDREGSIEITGFTHSLRLPTDALTGKVMGTRQHAPLLFQKEIDSSSP
YLMKAVATGQTLKTAEFKWYKINDAGQEVEYYNMTLENVKVVSVSPLMHDIKDPTKEKHNHLELVELRYD
KITWKFCDGNLQFADSWAER
-
Nucleotide Sequence: 483 bp     [Download]
>gi|392976867|ref|NC_018079.1|:2512938-2513420 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGGCTATACCGGTTTATTTATGGATACGAGATGATGGCAATACTGAAATAAAAGGAAGCGTAGACGTTC
AGGATCGAGAAGGCAGCATTGAAATCACCGGTTTTACACACAGTCTGAGATTACCTACCGATGCACTTAC
CGGAAAAGTAATGGGCACTCGTCAACATGCACCTTTGTTATTTCAGAAAGAAATTGACTCATCCTCCCCT
TACCTCATGAAGGCAGTAGCGACCGGACAAACACTTAAGACTGCGGAATTCAAATGGTATAAGATAAACG
ATGCAGGACAGGAAGTTGAATATTACAACATGACACTTGAAAACGTGAAAGTAGTTTCGGTTTCACCGCT
AATGCACGACATAAAAGATCCCACCAAAGAAAAGCATAATCATCTGGAACTGGTTGAGTTAAGGTACGAT
AAAATTACGTGGAAGTTTTGTGATGGAAATTTACAGTTTGCTGATAGTTGGGCGGAGCGTTAA