SecReT6
Effector Protein ID: 392979504
-
SecReT6 ID673
T6SS typeA3
Gene symbol-
Locus tagA3UG_13310
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2861707..2866098 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDI6RL97
KEGG IDenl:A3UG_13310
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 394..406
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 433..456
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 538..560
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 570..606
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 591..627
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 637..651
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 655..691
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 697..732
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 728..753
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 760..796
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 802..855
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 869..898
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 921..956
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 984..1009
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 1026..1041
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 1033..1065
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 1056..1084
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 3.50E-66, Aligned region: 1144..1163
PAAR_motif [PF05488], Evalue: 6.00E-15, Aligned region: 5..15
PAAR_motif [PF05488], Evalue: 6.00E-15, Aligned region: 100..219
RHS [PF03527], Evalue: 9.30E-14, Aligned region: 636..649
RHS [PF03527], Evalue: 9.30E-14, Aligned region: 737..753
RHS [PF03527], Evalue: 9.30E-14, Aligned region: 920..931
RHS [PF03527], Evalue: 9.30E-14, Aligned region: 933..946
RHS [PF03527], Evalue: 9.30E-14, Aligned region: 1116..1127
RHS [PF03527], Evalue: 9.30E-14, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 6.00E-05, Aligned region: 105..124
DUF4150 [PF13665], Evalue: 6.00E-05, Aligned region: 165..215
Protein Sequence: 1463 a.a.     [Download]
>gi|392979504|ref|YP_006478092.1| hypothetical protein A3UG_13310 [Enterobacter cloacae subsp. dissolvens SDM]
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGLAATAAAPLLGAGAAAAGVAAIGSSCLLSG
IVGGVLANLAGVTDDISNIAEGLGDALFPPSPAGKITTGSSNVLTNSLPAARAAGTLTPADTPPPEPQSP
GSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDKVACEKHSGPQYLAEGSKSVFINGQPAVRAK
DRTTCEGTVSDDVSPNVIIGGETLTVRDIKSGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGML
ADMAVNAVFGSSHPVHAATGVKVLNDDDELDFSLPGRFPLRWQRSYNSLTSREGLFGLGWATTFDSYLTL
EESNATWFDETGRELSFELPPVDRAFYSISEGIIIRRNESGDVAIADDDGAVWRLYKPTRVNPSVLRLAS
LSDEYGNALLTEWDEHGRLVGLHDEPRAIDVTLRYEDERFPQRVTAASHFDGSRSWPLMQWGYDARGQLA
SATDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWKKLDHWRVVENRTSTGDGCRFTYDLDAGLTTVEH
YDGQKRQHYWNAQNLIVRYVDERGENWRYAWDDNELLTQRIDPLGNAVTFVYDEMGNRVQEIDPDGNART
TTWLEHRGLPTAIIEADGSATRFWYDEHHGLKRVVDPMGQTTLLRRDEFGLVVEEVDAAGNSRHQEYNEA
GQVVRATDCSGRTTRYHYHPLGWLMIETGADGEETRYRYDAAGRPVQLDRPEGWTESLTWNKRGLPVKHA
GADGKESEFRYDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGPDSHLLEEVGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLTRIGLHPALSADAWS
TEAEQELSFEYDALGRVTREAGEHGELAWQYDALGNRTSVTLPDGRELKQFYYGSGHLLSIALDKLSVSD
FTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQRPSPRRWTRRWDYDYRNNLVREERDDNPFS
WYRWQYDSAGRLLVQDGTLPGQEQWRWDAAGNPLDGSAEKVTHNRLTQLNGIRWRYDIHGRTVEKDNGQT
RWHYRYDGEHRLTEVISQPRDRNRPQTQVSFRYDPLGRRISKTRQQMLGGQPTGKPVTTRFVWEGFRLLQ
ELHGDVPLTYVYSNQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDIEGQVRWEGVNSAWGKLLRESE
TQLSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYAPNALGWVDPFGLSN
LALPAPTSLDPWGSDAILHSMPVPKGGITVEMAMSPGQTQPGGWATVDHIPDVDYVRMKLAVIPEFKSDI
SHVQRFHIPEGVQIQVGPVGPQTSGGKIYPGGGSQIQILNYLDRAKLVPVGPPRKISSRTCGK
-
Nucleotide Sequence: 4392 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2866098-2861707 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGAGCGATAACAACGCGGCCCGCAAGGGTGACGAGATTATTCACTCCAGCATTTTCGCGGATATCACCA
GCATTGTGGCGGAAGGTGCCGCCTATGCGGTGATCGGCGCGGCGGTAGGGCTGGCAGCAACTGCCGCCGC
ACCTCTGCTGGGGGCGGGGGCAGCCGCTGCGGGCGTGGCGGCGATTGGCTCCAGCTGCCTGTTAAGCGGG
ATCGTCGGTGGCGTACTGGCTAACCTGGCGGGTGTTACTGACGATATCAGTAATATCGCGGAGGGGCTGG
GGGATGCGCTGTTCCCGCCGTCACCCGCAGGTAAAATCACCACCGGCTCCAGCAATGTGCTCACCAACAG
CCTTCCCGCTGCACGCGCGGCCGGAACGCTGACCCCCGCAGATACTCCACCCCCGGAGCCACAGTCACCG
GGTAGTTTTGCCGATTACGCGGGCATGTTGCTCTCCGCTGCCGGACAGTTCGGCAGTGAAATGTGGCAGC
CGAGCGTGGCCTCCGCTGCGGCGGGTACATCGCCGCTGGAAGAGGATAAGGTCGCGTGTGAAAAACACTC
CGGACCGCAGTATCTGGCGGAAGGCTCTAAAAGCGTCTTTATCAATGGACAACCGGCAGTACGTGCCAAA
GATCGCACCACCTGCGAAGGGACCGTTTCCGACGACGTTTCCCCGAATGTGATCATCGGCGGCGAGACGC
TGACGGTTCGCGATATCAAGAGCGGCAAAACGCCGGGGCTGGCACTGGGGATGATTGCGCTCTCCCTGCT
GCGCGGCCGTCCGGGCAAGATTTTGAAGAACATGCCCTGCGCGCTGGCGGCCGCGGGTGGCGGGATGCTG
GCCGATATGGCCGTCAATGCCGTATTTGGCTCCTCGCACCCGGTTCATGCCGCCACCGGCGTGAAGGTGC
TGAATGACGATGATGAGCTCGATTTCTCGCTGCCCGGGCGTTTTCCGCTTCGCTGGCAGCGCAGCTATAA
CAGCCTGACCTCCCGCGAAGGGTTGTTTGGCCTGGGCTGGGCAACAACCTTTGACAGTTATCTGACGCTT
GAAGAGAGCAATGCCACCTGGTTCGACGAAACCGGGCGTGAGCTGAGCTTTGAACTGCCACCCGTCGACC
GCGCGTTCTACAGCATCAGCGAGGGTATCATCATCCGCCGCAACGAGAGCGGTGATGTGGCGATTGCCGA
CGATGACGGCGCGGTGTGGCGCCTGTATAAACCGACACGCGTGAATCCATCCGTTCTGCGTCTGGCCTCC
CTTAGCGACGAATACGGCAACGCACTGCTGACGGAGTGGGATGAGCACGGCAGGCTGGTCGGTCTGCACG
ATGAGCCGCGGGCAATAGACGTCACCCTGCGCTATGAGGACGAACGGTTCCCGCAGCGCGTAACCGCTGC
CAGCCATTTTGACGGCAGCCGTAGCTGGCCGCTGATGCAATGGGGTTACGATGCGCGTGGCCAGCTGGCG
AGCGCGACGGATGCCTCTGGCGTCGTCACCCGCGAATACCGTTATAACGACCATGGTCTGATGGTCTGGC
ATCGTCTGCCGGGCGGGCTGGAAAGTGAATACCGCTGGAAAAAATTAGACCACTGGCGCGTGGTTGAAAA
CCGCACCAGCACCGGGGATGGCTGTCGTTTCACCTACGATCTGGACGCCGGGTTGACCACCGTCGAACAC
TACGATGGTCAGAAACGTCAGCACTACTGGAACGCGCAAAATCTGATCGTCCGCTACGTTGACGAGCGCG
GCGAGAACTGGCGCTACGCGTGGGATGACAACGAGCTCCTCACGCAACGCATCGATCCGCTCGGGAACGC
CGTCACCTTCGTTTACGACGAGATGGGCAACCGGGTGCAGGAGATCGACCCTGACGGCAATGCCCGCACC
ACGACCTGGCTTGAACACCGCGGGCTACCGACGGCCATCATTGAAGCCGACGGCAGCGCTACCCGGTTCT
GGTACGACGAACATCACGGCCTGAAGCGCGTGGTGGACCCAATGGGGCAGACCACGCTGCTGCGCCGGGA
CGAGTTTGGTCTGGTCGTTGAAGAGGTGGATGCCGCCGGAAACAGCCGCCATCAGGAGTACAACGAAGCG
GGACAAGTGGTGCGTGCGACAGACTGCTCTGGCCGCACCACCCGCTATCACTATCATCCGCTGGGCTGGT
TGATGATCGAGACGGGCGCCGACGGCGAAGAGACGCGTTATCGCTACGACGCTGCCGGGCGGCCGGTGCA
GCTCGATCGCCCGGAAGGCTGGACAGAGTCGCTTACATGGAACAAACGTGGCCTGCCAGTGAAGCATGCT
GGCGCTGACGGTAAAGAAAGTGAGTTCAGATACGATGAGGCCGGACGCTTAACCGCCACGCGTAATACGC
AGGGTGAGGAAGTTCGTCGCCGCTGGGACAGCAGAGGGCGTCTGATTGCCCTTGAAAATGAAAACGGCGA
AGCGTATCAGTTCCGCTGGGGGCCTGACTCGCACTTGCTGGAGGAGGTGGGGCTTGATGGTGTGGCCTCG
CAGTATCGCTACGACGCCTGTGGGCGCACGATAGCGCGCACCTTTGCTGCCGGTCATCCGGAGGCCATCA
CCCACGCCTTTGCCTGGAGCGCGAGCGGGCAACTGGTCGCCCGCACTACGCCGGAAGGGCAGACCCGCTA
CCACTATACCCCGTCAGGGCTGCTGACCCGGATTGGGCTGCACCCGGCGCTTTCAGCCGACGCGTGGAGT
ACCGAGGCCGAGCAGGAGCTTTCCTTTGAGTATGACGCACTTGGTCGCGTGACCCGCGAAGCGGGCGAGC
ACGGTGAGCTGGCGTGGCAGTATGATGCCCTTGGCAACCGCACCTCCGTTACGCTGCCGGATGGCCGCGA
ACTCAAACAGTTCTACTACGGCAGCGGGCATCTGCTCAGCATTGCCCTTGATAAGCTGTCGGTATCCGAC
TTTACCCGCGACGAACTCCACCGGGAGACCAGCCGCACGCAGGGCCTGCTCACCACCCGCAGCGAATACG
ACCGTTTAGGTCGCCTTCATCGCCGGGATGTCTTCACCGGCAACGCACAGCGCCCGTCACCACGCCGCTG
GACCCGCCGCTGGGATTATGACTACCGCAATAATCTGGTGCGGGAAGAACGGGACGATAACCCGTTCAGC
TGGTACCGCTGGCAGTACGACAGCGCCGGGCGCCTGCTGGTTCAGGACGGCACGCTGCCCGGGCAGGAGC
AGTGGCGCTGGGATGCGGCCGGTAACCCGCTCGACGGCTCTGCTGAGAAGGTCACGCACAACCGCCTGAC
GCAGCTGAATGGCATTCGCTGGCGTTATGACATCCACGGCCGCACCGTGGAGAAGGATAACGGCCAGACC
CGCTGGCACTACCGGTACGACGGTGAACACCGCCTGACGGAAGTGATCAGCCAGCCGCGGGATCGCAACA
GGCCACAGACGCAGGTCAGCTTCCGCTACGATCCGCTCGGGCGACGCATCAGCAAAACGCGCCAGCAGAT
GCTGGGCGGACAGCCAACCGGTAAGCCCGTCACCACCCGGTTTGTCTGGGAAGGGTTCCGCCTGCTGCAG
GAGCTGCACGGAGATGTACCGCTGACCTATGTCTACAGCAATCAGGACAGCTATGATCCGCTGGCACGTA
TTGACGGCGTTGATGCTCCGGAGATTTTCTGGTTCCACTGCCAGCCGAACGGCACGCCGGAACGGATGAC
GGATATTGAAGGGCAGGTGCGCTGGGAAGGCGTTAACAGCGCCTGGGGCAAGCTGCTACGGGAAAGCGAG
ACGCAGCTATCAGGATATTCCCAGAACCTGCGGATGCAGGGGCAATACCTGGATCGTGAGACAGGGCTGC
ACTACAATCTGTTCCGGTATTACGACCCGGACTGCGGGCGGTTTACGCAGCAGGACCCGATAGGGTTGGC
GGGAGGGATAAATCTTTACCAGTATGCACCGAATGCGCTGGGGTGGGTGGATCCATTTGGTTTAAGTAAC
TTAGCATTACCTGCTCCCACCTCCCTTGATCCATGGGGAAGCGATGCTATTTTACACTCTATGCCAGTTC
CTAAAGGTGGAATTACTGTTGAAATGGCAATGTCTCCAGGCCAAACTCAACCTGGAGGATGGGCTACCGT
TGATCACATCCCAGATGTCGACTATGTCAGAATGAAATTAGCTGTTATACCTGAGTTTAAATCAGATATA
TCTCATGTCCAAAGATTCCATATACCTGAGGGCGTGCAAATTCAGGTCGGCCCGGTTGGGCCGCAGACTT
CTGGAGGAAAAATATATCCAGGAGGGGGATCTCAAATTCAAATCCTTAACTATTTGGATCGAGCTAAACT
TGTGCCAGTCGGCCCACCCAGAAAAATCTCATCAAGAACATGTGGTAAATAA