SecReT6
Effector Protein ID: 392979528
-
SecReT6 ID673
T6SS typeA3
Gene symbol-
Locus tagA3UG_13440
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2891088..2891579 [-]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorECL_01542
DescriptionTae4_EC
UniProt IDI6S6N8
KEGG IDenl:A3UG_13440
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 6.90E-27, Aligned region: 42..160
Protein Sequence: 163 a.a.     [Download]
>gi|392979528|ref|YP_006478116.1| putative cytoplasmic protein [Enterobacter cloacae subsp. dissolvens SDM]
MSHMRPAFGAAWNRFKEVNVNVEQVGKLLGGKVKHNIDAGIFKNACPIRMSYVLNYCGIPVPSNSKYATV
TGSDKKRYMFRVKDMIAFLPTVLGKADISVSSPTPAQFAGKQGIIIFTGHGWLDATGHVTLWNGNICSDD
CHFLGSPGNGSFIPTNATFWSLK
-
Nucleotide Sequence: 492 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2891579-2891088 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGTCTCATATGCGTCCTGCTTTTGGTGCCGCCTGGAACCGATTTAAAGAAGTGAACGTCAACGTAGAAC
AGGTTGGCAAATTATTAGGGGGGAAAGTTAAGCATAATATAGATGCTGGTATTTTTAAAAATGCCTGCCC
CATTCGTATGAGCTATGTTTTAAATTATTGTGGCATTCCAGTTCCTTCTAATAGTAAATATGCAACTGTG
ACCGGGAGCGACAAGAAGCGATATATGTTCCGTGTTAAAGATATGATTGCTTTTTTACCCACGGTATTGG
GAAAAGCTGACATATCTGTTTCTTCTCCAACCCCAGCACAATTTGCGGGCAAGCAAGGTATTATTATTTT
TACCGGGCATGGCTGGCTTGATGCAACCGGGCATGTAACACTCTGGAACGGAAATATTTGTTCGGATGAT
TGTCATTTCCTTGGCTCACCGGGTAATGGTTCATTTATCCCTACTAACGCAACCTTCTGGAGCCTGAAAT
GA