SecReT6
Effector Protein ID: 392979529
-
SecReT6 ID673
T6SS typeA3
Gene symbol-
Locus tagA3UG_13445
StrainEnterobacter cloacae subsp. dissolvens SDM
Repliconchromosome [GenBank: NC_018079] [Browse all T6SS(s) in this replicon]
Location [Strand]2891638..2892120 [-]
Producttype VI secretion system secreted protein Hcp
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDI6RLB2
KEGG IDenl:A3UG_13445
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|392979529|ref|YP_006478117.1| type VI secretion system secreted protein Hcp [Enterobacter cloacae subsp. dissolvens SDM]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCASGKHLTKVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTT
SGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|392976867|ref|NC_018079.1|:c2892120-2891638 Enterobacter cloacae subsp. dissolvens SDM chromosome, complete genome
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCT
GGACTGATATTACCTCCTTCTCCTGGGGCGCTTCCCAGCCAGGTAATATGAGCGTTGGCGGTGGCGGCGG
TGCCGGTAAAGTTAACTTTAACGATCTGCACGTTAACGCTCTGATCGACAAATCCACCACAGCAATCCTG
AAACACTGCGCCAGCGGTAAACACTTGACCAAAGTTGAGCTGTCCGTCTGTAAAGCCGGTGGCCAGCAGG
TGGAATATTCCCGCATCACGCTGGAAGACGTTCTGGTAACGTCTGTTCAGTACACCGGTGCAGACAACGG
CGATACCGTTGGTGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACCACC
TCTGGTGGTAAAGGTGCTGAAAGCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCATAA