SecReT6
Effector Protein ID: 392981513
-
SecReT6 ID674
T6SS typeA3
Gene symbol-
Locus tagPADK2_00515
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]119305..120465 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0099
DescriptionPA0099
UniProt IDI6SKZ2
KEGG IDpdk:PADK2_00515
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 8.30E-38, Aligned region: 19..134
Tox-GHH2 [PF15635], Evalue: 2.20E-33, Aligned region: 226..344
Protein Sequence: 386 a.a.     [Download]
>gi|392981513|ref|YP_006480100.1| hypothetical protein PADK2_00515 [Pseudomonas aeruginosa DK2]
MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVM
LKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWP
YLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTAR
RCALQPYKPNSCCPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMH
TFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINA
RTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR
-
Nucleotide Sequence: 1161 bp     [Download]
>gi|392981410|ref|NC_018080.1|:119305-120465 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAGCGGCAAGTCCATCGCGG
CCTTCCCGGATGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCC
CAATACCGGCCTGTCCAAGGACACCACCAAAGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATG
CTGAAGAACAAGAGCTACTACAAGACCAGCTACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCG
TCACCAGCAAGATCAAGGGCAAGGTGTACTTCACCTCCTGGTCGATGAACGTCAAGTTCGAAAGCAAGAA
CGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCTGGCAATACGCCGGTCTGGCCC
TACCTCGACCAGGCCACCGTCGATGCTGGTGGTGGACCGTGCAGCAATGAAGTGAAGAAGGAGAAGAAGG
ATTGCGCTGACTTCAAGCCGCATGGCAGCAAGGATGCCTGCGCTGGCCTTGGCGCGGGCAAGCCTTCCGG
CAAGAAGACCAGCAACGAAGCTGACCGACTGGCAGACAAGGTCGCTGCCCGAAAATGCCTGACCGCGCGC
CGGTGTGCCCTGCAACCGTACAAGCCGAACAGTTGCTGCCCGCAGCAGACCGCTCACCACCTGATCGAGG
CCAGCGCCTTGCACGACAAGGGACGTGGTGGAAAAGGCTCGGTACCCCTCAAGGGGATATCCAACTATTC
GGAGAACAAGGCTCCTTGCGTCTGCGCGGAGGGCGTCAATCAGAACGTGGGTACCCACGGCCTCATGCAC
ACGTTCCAGAGCGCCGCTGCCGCGAAGTCGCGCAGTGGAACCCTGCAATTGTCCAATGGCAGCTCCATCT
CCGCGAAGAAGACCACCTACGGAACGGCGAAACGTCAATCCATGGCTGCCATGGGCAAGGTCTTTCCGCA
GTCGAAATGCTCGAAGGAATGTCTGTCCGCTCAGCTCGACAACTATCACAAGCAGTGCGGAATCAACGCC
AGAACACCCATCAAGGCCGTTGAAACCGGCCAGACCGACGTCACGGCTGCGACGCAGGCGATAAAGACCC
GCAATGCGCGTCTTGGCGCCACGAGGAGTCGAGTCCGCTAG