SecReT6
Effector Protein ID: 392983642
-
SecReT6 ID674
T6SS typeA3
Gene symbol-
Locus tagPADK2_11220
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]2379070..2381139 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDI6RKB5
KEGG IDpdk:PADK2_11220
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-85, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 1.10E-85, Aligned region: 347..396
Phage_base_V [PF04717], Evalue: 5.20E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 553..575
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 4.40E-05, Aligned region: 645..683
Protein Sequence: 689 a.a.     [Download]
>gi|392983642|ref|YP_006482229.1| hypothetical protein PADK2_11220 [Pseudomonas aeruginosa DK2]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSR
RHFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRER
DHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCI
DAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSVQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAERNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|392981410|ref|NC_018080.1|:2379070-2381139 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGCTGTTCTCCCAACACACCCGCCTGGTACACGTGGACTCCCCGCTGGGCCCCGAGGTCCTGCAACTGC
AACGGCTGGAAGGCCGCGAGGAGCTGGGCCGGCTGTTCAGCCACGAACTCGAACTGGTCTCGAGCAATCC
CGCCTTGCCTCTGGATGCCCTGTTGGGCAAGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGTAGCCGG
CGGCACTTCCACGGCATCGTCGCGCGCTGTAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGTGTGCAATACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGG
CGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTATTACCCGCCGAGCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCACATGGCGCGCGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCACCCGCCTGGAAGTGCGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCC
GCTCTACGACTACCCTGGCGAGTATGTGCAGAGCCAGGACGGCGAACACTATGCACGGACCCGCATCGAG
GCGATCCAGACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGT
TCCACCTGAGCAACTACCCGCGCCTGGACCAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGT
AGTCCAGGAACTCTACGAGACCGGTAATGGCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATC
GACGCCGGCCAGGCTTTCCGCCCCTTGCCGTCGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTATGGCCGGGTCAAGGTGCATTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATGCGCGTCTCCCAGGCCTGGGCGGGGAAG
AACTGGGGCTCGGTGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACGGTGCATGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGAC
CGTAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCATGGCCTCGTTACAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTAGT
CGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGATGGCTCGAAGATCACCCTGGACGGTCAGAGCATCACCCTTGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGA
GATCGAGATCCTCTCGCCCAATGTCGATATCAACTGTTGA