SecReT6
Effector Protein ID: 392986766
-
SecReT6 ID675
T6SS typeA4a
Gene symbol-
Locus tagPADK2_26940
StrainPseudomonas aeruginosa DK2
Repliconchromosome [GenBank: NC_018080] [Browse all T6SS(s) in this replicon]
Location [Strand]5827018..5829255 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDI6T3V0
KEGG IDpdk:PADK2_26940
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 1.50E-06, Aligned region: 635..687
Protein Sequence: 745 a.a.     [Download]
>gi|392986766|ref|YP_006485353.1| hypothetical protein PADK2_26940 [Pseudomonas aeruginosa DK2]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARTRIAELEAENAEIQRTLDSSG
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGIAQPNPDLARAMREELWGLHAYEVAATT
KDNFELWNQTMDKNWKQQRNDEPLTSHLLRLWDVITPYSPSFTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|392981410|ref|NC_018080.1|:c5829255-5827018 Pseudomonas aeruginosa DK2 chromosome, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTATACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCTTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGCTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGAGTGCAGGCGCGAGTGCTGGTCTGGAGCAACCAACTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCAGTG
GACAACGAGGTGCTGCGACTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAGCGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGACGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGGG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAGGTACGCCTCGTCAATGGGCGACTGCAAAGCCTGATCCAC
CTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGCCCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGGACCCAGCCG
CAGGACGACGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAGGCGCTCGAAGAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATCTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGCCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCTGCCCCCGGCAGCCCGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCACCG
CCGCTGAAGGCGCGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGACGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGACTACATGCGTATGAAGTGGCTGCAACAACC
AAGGACAACTTTGAACTTTGGAATCAAACAATGGACAAGAACTGGAAACAGCAGCGAAACGATGAACCTC
TCACTAGCCATCTATTACGGTTATGGGATGTCATAACACCTTATAGCCCGAGCTTTACGGTGGATTAA