SecReT6
Effector Protein ID: 397655590
SecReT6 ID677
T6SS typeA2
Gene symbol-
Locus tagA225_0518
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]535414..535899 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDI6WXA0
KEGG IDkoe:A225_0518
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-40, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|397655590|ref|YP_006496292.1| hypothetical protein A225_0518 [Klebsiella oxytoca E718]
MDVIFLKLDNIEGESQAKGFEKQLEIMTFSHNVAMPVTNDVSNNERTSGRAHVGEMSLTKFVDLATPKLN
EYCCSGKMIKEAVLTLCRNDNGKMLPFIIYTLTNVVISHLSVSGGSGGKPVETMSLNFTKIKWEISAQKS
DSQKEGNVSSVWDMATNKKGS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|397655102|ref|NC_018106.1|:535414-535899 Klebsiella oxytoca E718 chromosome, complete genome
ATGGATGTGATTTTTTTAAAGCTCGACAATATCGAAGGTGAAAGTCAGGCCAAAGGATTTGAAAAACAGC
TTGAGATCATGACCTTCAGCCATAACGTGGCGATGCCGGTCACCAACGACGTCAGTAATAATGAACGCAC
CTCAGGGCGGGCGCATGTCGGTGAAATGTCGTTGACCAAGTTTGTCGATCTCGCGACGCCAAAGCTCAAT
GAGTACTGCTGTAGCGGGAAAATGATTAAAGAAGCTGTGCTGACGTTGTGCCGTAATGATAACGGTAAAA
TGCTGCCATTCATCATATATACCCTGACGAATGTCGTTATCTCACATCTGAGCGTTAGCGGCGGTTCCGG
CGGCAAGCCGGTCGAAACAATGTCGCTGAACTTTACCAAAATTAAATGGGAAATCAGCGCTCAGAAATCG
GATAGTCAGAAAGAAGGCAACGTCTCTTCCGTTTGGGATATGGCGACGAATAAAAAAGGTAGCTGA