SecReT6
Effector Protein ID: 397657644
SecReT6 ID677
T6SS typeA2
Gene symbol-
Locus tagA225_2631
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]2776816..2777307 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDI6WP49
KEGG IDkoe:A225_2631
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|397657644|ref|YP_006498346.1| hypothetical protein A225_2631 [Klebsiella oxytoca E718]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFRWYKINDAGQEVEYFNTKLENVKVVKVSSLMHDVKDPSYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|397655102|ref|NC_018106.1|:2776816-2777307 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCAATTCCAGTCTATCTGTGGCTGAAGGACGACGGCGGCGCGGACATCAAAGGTTCCGTGGACGTGA
AGGACCGCGAGGGCAGCATCGAGGTGGTGGCGCAGGAGCATAACCTGTACATCCCGACCGACAACAACAC
CGGGAAGCTGACCGGCACGCGTATCCACACGCCGTTCTTGTTCACCAAGGAAATCGACGCCTCCAGCCCG
TACCTGTACAAGGCGGTGACCACCGGCCAGACGCTGAAGTCGGCGGAGTTCCGCTGGTACAAAATCAACG
ACGCCGGTCAGGAAGTGGAGTACTTCAACACGAAGCTTGAGAACGTGAAGGTGGTGAAGGTCAGCTCGCT
GATGCACGACGTCAAGGACCCGTCCTACGAGAAGCATAACCACCTCGAGCAGATTGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAGGACGGCAACATCATTCATTCCGACAGCTGGAACGAACGCGCCACCGCCT
GA