SecReT6
Effector Protein ID: 397658376
SecReT6 ID678
T6SS typeA2
Gene symbol-
Locus tagA225_3375
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3557108..3557599 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDI6W6U7
KEGG IDkoe:A225_3375
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|397658376|ref|YP_006499078.1| hypothetical protein A225_3375 [Klebsiella oxytoca E718]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVIAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVSPEMYDIKDPSKEKHNHLERVELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3557599-3557108 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGATCTGTGGACGTTC
AGGATCGCGAGGGCAGCATCGAAGTTATCGCTCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACCCGTATCCACACGCCGTTCCTGTTCACCAAGGAAATCGACTCGTCCAGCCCG
TATCTGTACAAGGCGGTGACCACCGGTCAGACCCTCAAGTCTGCGGAATTCAAGTGGTACAAGATCAACG
ACGCGGGCCAGGAAGTGGAGTACTTCAACACCAAACTCGAAAACGTGAAGGTGGTGAAAGTGAGCCCTGA
AATGTACGACATCAAGGATCCTTCTAAAGAGAAGCACAACCATCTTGAGCGCGTAGAACTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA