SecReT6
Effector Protein ID: 397659095
-
SecReT6 ID679
T6SS typeA2
Gene symbol-
Locus tagA225_4105
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4327978..4328469 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDI6X604, I6X604
KEGG IDkoe:A225_4105
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|397659095|ref|YP_006499797.1| hypothetical protein A225_4105 [Klebsiella oxytoca E718]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVSPEMYDIKDPSKEKHNHLERVELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4328469-4327978 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGATCTGTGGACGTTC
AGGATCGCGAGGGCAGCATCGAAGTTGTCGCTCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACCCGTATCCACACGCCGTTCCTGTTCACCAAGGAAATCGACTCGTCCAGCCCG
TATCTGTACAAGGCGGTGACCACCGGTCAGACCCTCAAGTCTGCGGAATTCAAGTGGTACAAGATCAACG
ACGCGGGCCAGGAAGTGGAGTACTTCAACACCAAACTCGAAAACGTGAAGGTGGTGAAAGTGAGCCCTGA
AATGTACGACATCAAGGATCCTTCTAAAGAGAAGCACAACCATCTTGAGCGCGTAGAACTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA