SecReT6
Effector Protein ID: 397695246
hcpC
SecReT6 ID685
T6SS typeA4b
Gene symbolhcpC
Locus tagT1E_2490
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]2732940..2733368 [+]
Producthcp protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDI7B008
KEGG IDppx:T1E_2490
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-33, Aligned region: 6..137
Protein Sequence: 142 a.a.     [Download]
>gi|397695246|ref|YP_006533127.1| hcp protein [Pseudomonas putida DOT-T1E]
MPTPAYIKIIGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIF
TSSLNKATPLMYQALATGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTR
PL
-
Nucleotide Sequence: 429 bp     [Download]
>gi|397692770|ref|NC_018220.1|:2732940-2733368 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCCAACACCCGCTTACATCAAGATCATAGGCCAGACCCAAGGCAACATCACCGCGGGCGCCTTCACCG
CTGACTCCGTCGGCAACGTGTTCCAACAAGGCCATGAAGATCAGATTCTGGTTCAGGAAATCAAGCATGA
GGTGACTACGCCCACTGACCCCCAGAGCGGTCAACCGAGTGGCCAGCGCGTGCATAAGCCTTTCATATTC
ACCAGTTCACTGAACAAAGCTACCCCCCTGATGTATCAGGCACTTGCCACCGGCGAAATGCTGCCAACGG
TCGAGGTCAGCTGGTATCGCACCTCGTCGGAAGGCAAACAAGAGCATTTTTTCACCACCACGCTCGAAGA
CGCCACCATCGTCAGCATCAATACCGTGCTTCCCCACGCACTCGACAAAGACAATGAAAACTACACCCGG
CCGTTGTAG