SecReT6
Effector Protein ID: 401762657
-
SecReT6 ID686
T6SS typeA3
Gene symbol-
Locus tagECENHK_05765
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]1258601..1262788 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorECL_03140
DescriptionrhsB
UniProt IDJ7GFB6
KEGG IDeno:ECENHK_05765
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 380..401
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 418..436
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 478..493
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 509..529
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 549..586
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 592..616
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 636..672
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 699..732
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 720..756
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 762..789
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 813..844
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 865..897
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 927..953
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 977..1006
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 1014..1033
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 1051..1088
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 1071..1109
RHS_repeat [PF05593], Evalue: 2.10E-48, Aligned region: 1170..1185
PAAR_motif [PF05488], Evalue: 5.80E-16, Aligned region: 4..15
PAAR_motif [PF05488], Evalue: 5.80E-16, Aligned region: 26..49
PAAR_motif [PF05488], Evalue: 5.80E-16, Aligned region: 85..155
RHS [PF03527], Evalue: 1.20E-14, Aligned region: 547..560
RHS [PF03527], Evalue: 1.20E-14, Aligned region: 723..750
RHS [PF03527], Evalue: 1.20E-14, Aligned region: 1044..1061
RHS [PF03527], Evalue: 1.20E-14, Aligned region: 1162..1199
AHH [PF14412], Evalue: 2.70E-13, Aligned region: 1280..1373
DUF4150 [PF13665], Evalue: 5.10E-05, Aligned region: 88..115
DUF4150 [PF13665], Evalue: 5.10E-05, Aligned region: 121..155
DUF4595 [PF15283], Evalue: 0.0043, Aligned region: 376..396
DUF4595 [PF15283], Evalue: 0.0043, Aligned region: 418..446
DUF4595 [PF15283], Evalue: 0.0043, Aligned region: 609..676
DUF4595 [PF15283], Evalue: 0.0043, Aligned region: 752..764
DUF4595 [PF15283], Evalue: 0.0043, Aligned region: 996..1080
Protein Sequence: 1395 a.a.     [Download]
>gi|401762657|ref|YP_006577664.1| Rhs family protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MFEAARVGDDIGHSGALAGMIAGTIVGGLIAAAGGILAGAMFIAGLGASCLGVGVLLVGASLAVGYYTGE
LATAARDSIADAGASSMTKKGVITSGSPNVFINGKPAALATDSTVDCSDDGSQQMAEGSKRVFINSQPAS
RIGDRTTCDAKVMTGSDNVIIGGDPQQTLPIQSEVPEWLYKVSDLTLLFAGLLGGWGGAAGKVGALSKLL
GKIPGINKLARIACRAGTLMTGVAAAGIIARPVDIVSGQKFLSGDDELDFVLPSRLPVRWQRYWRSGNPG
DSVLGRGWSLFWESRLEPYQDGLVWRAPSGDYIAFPNVPKGMRTYCESEKNWLEHHSDDSWSVYDVSGER
WHYAPLKDDAPSLLQRISEPCGNAILFEWNANNTLHALTDSAGQRVVCRYDSDRLAGAWLDDEICLVSYA
YDEQRQLVCVTGRGGSVRRRFRWQDGLMSAHEDANGLLSEYRWQEIDGLPRVVGFRHSGGEQLTFEYDFD
NGTRRATRDDGAQAHWLVDDDDNVARFTDYDGRQTTFVYRDGELCDVILPGGAMRRSTWDKYGRMTSETD
PAGRRTEYHWYRLTDRITRTVYPDGTSSQAMYDLRGRLLSETDPAGNATAYDYPDDQENLPESITDAIGG
VVRLVWNHQGLLTQRTDCSGSVTRFTYDRFGQLIASENAEGNITRREWSRAGLLSAVIHPDGSRESLVWN
ERGQLTGWRDPLESEVSWAYNALGLPVSLTDRIGRVRQWRYDPRGNLLRLDNGNGAEYRFTYDAVGRPLS
ETRPDDTVRHMEWDARGFLCALEENGRPAADGGIARRVQQFSYDDSGLLIGRTQRHAEYRYFRDLSGQIT
RIRRTPTAEGVALGIESDEIVYRHDANGRVLSESGINGAVGYEWDALSNLTGLTLPGEQKLAWLHYGSGH
VSAIRFGQQLVTEFTRDRLHREVRRTQGAREQLRQYDSLGRRTLQRSELSTDVTLPEKALLERLYRYTAR
GELSGVSDTLRGEVDYGYDAEGRLLKHYEARQGHSRAQFSYDAADNLAASDDAAPVTDNRLQHWQALFMK
YDHWGNLVSRRNGLYEQHYAYDAENRLVSARGTGPEGRFEARYHYDALGRRTRKIVTTTHGTTETRFLWQ
GYRLLQEQQESGLCNTYINDPNEAWSPLARVDHLRDQNSGEIYWFNTDLNGAPLEVTDERGAVRWSGQYG
SFGEVRHQSEGFSRLVNRTAMAHQPLRYAGQYADGETGLHYNLFRYYDPQVGRFIVQDPIGLNGGWNLYQ
YAPNPLGWIDPLGLLTYNTMPSITGFQKHHIIPQQLKGHDLIKAADFNIHDIKNVIYLPKSADYHPTRTI
HSGSHPVYTKNIGDQMDAIYEYGKENGWKQAEYKQAVSEIIKNERADLRGGKTILNKNSVRKARC
-
Nucleotide Sequence: 4188 bp     [Download]
>gi|401761514|ref|NC_018405.1|:1258601-1262788 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGTTTGAAGCTGCACGCGTAGGTGATGATATCGGCCACTCCGGTGCGCTTGCCGGGATGATTGCCGGAA
CGATTGTCGGCGGCCTGATTGCCGCCGCCGGGGGCATTCTGGCGGGGGCGATGTTTATTGCCGGACTTGG
CGCATCCTGCCTGGGCGTGGGCGTCCTGCTCGTCGGCGCGAGCCTGGCCGTGGGGTACTACACCGGGGAG
CTGGCGACCGCCGCCCGCGACAGCATCGCGGACGCCGGGGCATCCAGTATGACGAAGAAAGGCGTCATCA
CTTCCGGCTCGCCCAATGTGTTTATCAACGGTAAACCCGCCGCGCTTGCCACCGATAGCACCGTCGACTG
TTCTGACGACGGCTCGCAGCAGATGGCCGAAGGCTCTAAGCGAGTCTTCATTAACAGCCAGCCTGCGTCC
CGCATCGGGGATCGTACCACCTGCGACGCGAAGGTGATGACCGGTTCGGACAACGTCATCATCGGCGGCG
ACCCGCAGCAAACCCTGCCCATTCAGTCTGAAGTCCCCGAGTGGCTGTATAAAGTCTCCGATCTTACCCT
GCTGTTCGCCGGCCTGCTCGGCGGGTGGGGCGGTGCCGCTGGCAAAGTTGGGGCGCTGTCTAAGCTGCTG
GGGAAAATTCCCGGTATCAATAAGCTGGCCCGTATCGCCTGCCGCGCCGGCACGCTGATGACCGGCGTTG
CCGCCGCGGGGATCATCGCCCGCCCGGTGGATATCGTCAGCGGCCAGAAGTTTCTCAGCGGGGATGATGA
GCTGGACTTCGTCCTGCCTTCCCGTCTGCCGGTGCGCTGGCAGCGCTACTGGCGCAGCGGCAACCCCGGC
GACAGCGTGCTGGGCCGCGGGTGGAGCCTGTTCTGGGAAAGCCGCCTGGAGCCGTATCAGGACGGGCTGG
TGTGGCGTGCACCGTCCGGTGATTACATCGCCTTCCCGAATGTCCCGAAAGGGATGCGCACCTACTGCGA
AAGCGAAAAAAACTGGCTTGAGCACCACTCTGACGACAGCTGGTCGGTGTATGACGTCAGCGGCGAGCGC
TGGCACTACGCGCCGCTTAAGGATGATGCCCCGTCGCTGCTCCAGCGCATCTCTGAACCCTGCGGCAACG
CTATCCTCTTCGAGTGGAATGCGAATAATACTCTGCATGCCCTTACCGACAGCGCGGGCCAGCGCGTAGT
CTGCCGCTACGACAGTGACAGGCTTGCCGGTGCCTGGCTGGATGACGAGATCTGCCTGGTCAGTTACGCT
TATGATGAACAGCGCCAGCTGGTCTGTGTGACCGGCCGGGGCGGTAGCGTGCGCCGACGCTTCCGCTGGC
AGGACGGGCTGATGAGCGCCCATGAGGACGCCAACGGCCTGCTGAGCGAATACCGCTGGCAGGAGATTGA
TGGCCTGCCGCGCGTGGTCGGCTTCCGCCACAGCGGCGGTGAACAGCTGACGTTCGAATACGATTTTGAT
AACGGCACCCGCCGTGCGACCCGCGATGACGGCGCGCAGGCGCACTGGCTGGTGGACGACGACGACAACG
TTGCGCGCTTCACGGATTACGACGGTCGTCAGACGACGTTTGTTTACCGCGACGGCGAACTCTGCGACGT
CATTCTCCCCGGCGGCGCGATGCGCCGCAGCACGTGGGACAAATACGGCCGCATGACCAGCGAGACGGAC
CCGGCGGGCCGCCGTACGGAGTATCACTGGTATCGCCTGACCGACCGCATCACCCGGACAGTGTATCCGG
ACGGTACCTCATCGCAGGCCATGTACGACCTTCGCGGTCGCCTGCTGTCGGAAACGGATCCGGCCGGTAA
CGCCACCGCGTATGACTATCCCGACGATCAAGAAAACCTGCCGGAGAGCATCACCGACGCCATTGGCGGC
GTGGTGCGTCTGGTCTGGAACCACCAGGGGCTACTGACGCAGCGCACCGATTGCTCCGGCAGCGTGACCC
GCTTTACCTACGACCGATTCGGGCAGCTGATTGCCAGCGAGAATGCGGAAGGGAATATTACGCGCCGGGA
ATGGAGCCGTGCCGGGCTGCTGAGCGCCGTGATCCACCCGGACGGCAGCCGTGAGTCGCTGGTGTGGAAC
GAACGCGGCCAGCTCACGGGCTGGCGCGACCCGCTGGAAAGCGAAGTGAGCTGGGCCTATAACGCGCTCG
GCCTCCCGGTCAGCCTTACCGACCGAATTGGCCGCGTGCGCCAGTGGCGCTATGACCCGCGCGGTAACCT
GCTGCGGCTCGATAACGGCAACGGGGCGGAATACCGCTTCACCTACGACGCCGTGGGCCGCCCGCTCAGC
GAAACGCGCCCGGACGATACCGTGCGCCATATGGAATGGGACGCGCGAGGGTTCCTCTGCGCGCTTGAAG
AGAACGGCCGGCCTGCCGCCGACGGCGGCATCGCCCGTCGCGTCCAGCAGTTCAGCTATGACGACAGCGG
GCTGCTGATCGGGCGCACTCAGCGCCACGCGGAGTACCGCTACTTCCGCGACCTGAGCGGCCAGATTACC
CGCATCCGCCGCACGCCAACCGCAGAAGGCGTTGCCCTGGGTATCGAAAGCGATGAGATTGTTTACCGGC
ATGACGCCAACGGGCGCGTGCTGAGCGAATCCGGTATTAACGGCGCGGTGGGCTACGAATGGGATGCCCT
GAGCAACCTGACCGGCCTGACGCTGCCCGGCGAGCAAAAGCTGGCCTGGCTGCACTACGGCTCCGGCCAC
GTCAGCGCCATCCGCTTCGGGCAGCAGCTGGTGACCGAGTTCACCCGCGACCGCCTGCACCGCGAGGTGC
GCCGCACCCAGGGCGCGCGCGAGCAGCTTCGTCAGTATGACAGCCTCGGCAGACGCACCCTTCAGCGCAG
TGAGCTGAGTACGGACGTGACCCTGCCGGAGAAGGCGCTCCTGGAACGGCTGTATCGCTACACCGCGCGC
GGCGAGCTTTCCGGCGTCAGCGACACCCTGCGCGGTGAGGTGGATTACGGCTACGACGCCGAAGGTCGTC
TGCTGAAGCACTACGAGGCCCGCCAGGGGCACAGCCGCGCGCAGTTCAGCTATGACGCCGCGGATAACCT
CGCCGCCAGTGACGATGCGGCACCGGTCACGGATAACCGCCTGCAGCACTGGCAGGCGCTGTTCATGAAA
TACGACCACTGGGGCAACCTGGTCAGCCGCCGCAACGGGCTGTATGAACAGCATTATGCGTATGACGCCG
AGAACCGGTTGGTATCCGCCCGCGGAACCGGGCCGGAAGGGCGGTTTGAGGCGCGCTATCACTACGACGC
GCTGGGCCGCCGCACGCGCAAAATCGTCACTACGACGCACGGCACCACCGAAACGCGCTTCCTGTGGCAG
GGCTACCGCCTGCTGCAGGAGCAGCAGGAGAGCGGGCTGTGCAACACCTATATCAACGACCCGAATGAAG
CCTGGAGCCCGCTGGCGCGGGTGGATCATCTTCGTGACCAGAACAGCGGTGAGATTTACTGGTTCAACAC
CGACCTGAACGGCGCGCCGCTGGAAGTGACCGACGAGCGCGGCGCGGTGCGCTGGAGCGGCCAGTACGGC
AGCTTTGGCGAGGTACGTCATCAGAGCGAAGGGTTCTCACGGCTTGTGAATCGCACGGCGATGGCGCATC
AGCCGCTTCGCTATGCCGGGCAGTATGCTGACGGTGAAACGGGGCTGCATTATAACCTGTTCCGCTACTA
CGACCCGCAGGTCGGGCGGTTTATTGTGCAGGATCCGATTGGGCTGAATGGCGGGTGGAACCTTTATCAG
TATGCGCCGAATCCGTTGGGGTGGATCGATCCGCTGGGATTGCTGACCTATAACACGATGCCGAGTATTA
CTGGTTTCCAAAAGCATCATATTATTCCACAACAGTTAAAAGGCCATGATTTAATAAAAGCGGCTGATTT
TAATATCCATGATATTAAAAATGTTATTTATTTACCTAAGTCAGCTGATTACCATCCGACAAGAACAATC
CATAGTGGGTCTCACCCTGTTTATACAAAAAATATAGGTGACCAGATGGATGCTATATATGAATATGGGA
AGGAAAACGGCTGGAAACAAGCAGAGTATAAACAAGCTGTTAGTGAAATTATAAAAAATGAACGTGCCGA
TTTACGCGGTGGAAAAACTATTCTTAACAAAAACTCGGTTAGAAAAGCGAGGTGCTAA