SecReT6
Effector Protein ID: 401763821
-
SecReT6 ID686
T6SS typeA3
Gene symbol-
Locus tagECENHK_11715
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2510222..2510704 [+]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDJ7GBX8
KEGG IDeno:ECENHK_11715
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.20E-34, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|401763821|ref|YP_006578828.1| Hcp family type VI secretion system effector [Enterobacter cloacae subsp. cloacae ENHKU01]
MAIPAYLWLKDDGGADIRGAVDVQEREGSIEVLGFGHGLHLPTDNMTGKITGTRIHSALVFEKEFDSSSP
YLYKAVAKGQTLKSAEFKWYKINDAGQEVEYFNMFLEDIKVVSISPLMHDIKNPATERHNHLESIALRYE
KITWKHCDGNINFCDEWKDR
-
Nucleotide Sequence: 483 bp     [Download]
>gi|401761514|ref|NC_018405.1|:2510222-2510704 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGCAATTCCGGCATACCTATGGCTTAAAGATGACGGCGGTGCAGATATTAGGGGCGCTGTTGATGTAC
AGGAACGCGAGGGCAGTATCGAGGTGTTGGGATTCGGTCATGGGCTACATTTGCCAACAGATAACATGAC
GGGAAAAATTACTGGCACGCGTATCCATTCAGCGCTTGTCTTTGAGAAAGAATTTGACAGTTCAAGTCCA
TATCTCTACAAAGCCGTCGCAAAAGGTCAGACTCTAAAAAGTGCCGAATTCAAATGGTATAAGATCAACG
ATGCCGGACAGGAAGTTGAATACTTCAATATGTTTTTGGAAGACATTAAAGTCGTATCCATATCTCCACT
CATGCATGATATCAAAAACCCAGCAACAGAGAGACATAACCATCTAGAAAGTATCGCATTGCGTTACGAA
AAAATAACCTGGAAGCACTGTGACGGTAACATTAATTTTTGTGACGAGTGGAAAGACAGATGA