SecReT6
Effector Protein ID: 401764089
-
SecReT6 ID686
T6SS typeA3
Gene symbol-
Locus tagECENHK_13095
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2771675..2776150 [-]
ProductRhsB
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDJ7GLP9
KEGG IDeno:ECENHK_13095
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 394..406
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 433..457
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 538..561
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 570..593
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 591..628
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 655..691
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 697..733
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 721..753
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 760..796
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 802..855
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 869..897
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 921..956
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 964..994
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 984..1009
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 1033..1063
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 1056..1084
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 8.50E-65, Aligned region: 1150..1165
PAAR_motif [PF05488], Evalue: 7.60E-15, Aligned region: 5..15
PAAR_motif [PF05488], Evalue: 7.60E-15, Aligned region: 100..219
RHS [PF03527], Evalue: 6.30E-13, Aligned region: 737..753
RHS [PF03527], Evalue: 6.30E-13, Aligned region: 933..945
RHS [PF03527], Evalue: 6.30E-13, Aligned region: 1116..1127
RHS [PF03527], Evalue: 6.30E-13, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 0.0001, Aligned region: 105..124
DUF4150 [PF13665], Evalue: 0.0001, Aligned region: 165..215
Protein Sequence: 1491 a.a.     [Download]
>gi|401764089|ref|YP_006579096.1| RhsB [Enterobacter cloacae subsp. cloacae ENHKU01]
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATVAAPLLGAGAAAAGVAAIGSSCLLSG
IIGGVLANVAGITDDISNAAEGLGNALFPPSPAGKITTGSNNVLTNAIPAARAAGTLTPADTPSPEPQSP
GSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDKVACEKHSGPQYLAEGSKSVFINGQPAVRAK
DRTTCEGTISDDVSPNVIIGGDTLTVRDIKSGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGML
ADMAVNAVFGSSHPVHAATGVKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATPFDSYLTL
EENNATWFDETGRELSFELPPVDRAFYSISEGIIIRRNENGDVAIADDDGAVWRLYKPTRANPAVLRLAS
LSDEYGNALLTTWDEHGRLVGLHDEPRAIDVTLRYEDERFPQRVTSASHFDGNRSWPLMQWRYDAGGQLA
SATDASGVVTREYRYNDRGLMVWHRLPGGLESEYRWQKFDHWRVVENRTSTGDGCRFSYDLAAGLTTVEH
YDGQTRKHYWNAQNLIVRYVDERGENWRYEWDDNELLTRRVDPLGNAVTFVYDEMGNRVQEIDADGNTRT
TTWLEHRALPAAIIEADGSATRFWYDEHHGLKRVVDPMGQTTLLHRDEFGQVVEEVDAAGNSRYQEYNDA
GQMVRATDCSGRITRYRYHPLGWLVAETGADGEETRYRYDAAGRPVQLDRPEGWTESLAWNERGLPVKHA
GADGKESEFRYDDAGRLTATRNTQGEEVRRRWDSRGRLVALENENGEAYRFRWGADSLLLEETGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLSRIGLHPELSADAWT
TEAEQELAFDYDALGRVTREAGEHGELAWEYDALGNRTSLTLPDGRELKQFYYGSGHLLGIALDKLSVSD
FTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQRPSPRRWSRRWDYDYRNNLVREERDDNPFS
WYRWQYDSAGRLLVQDGSLPGQEQWRWDAAGNPLEDSAEKVTHNRLTQLNGIRWRYDIHGRTVEKDNGQT
RWHYRYDGEHRLTEVISQPRDRNKPQTQVNFRYDPLGRRISKTRRQMLGGQPTGKPVTTRFVWEGFRLLQ
ELHGDVPLTYVYSDQDSYDPLARIDGVVAPEIFWFHCQPNGTPERMTDIEGQVRWDAVNSAWGKLLRESE
TQVSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYAPNALGWVDPWGLSR
ECSGKTKPDFYVGPAGPSATMPSTAYRYVRYLNDDGSLDKWAPGLLETKKAPVTYFGFEKFETGKAARDA
FQIKGPDKVDPTLPADVSWSDARIRGTFDTLQLYENGTPQVRHPRMFGDEIGAPLEQFTHAYPQYGKGGV
EQMHAEKRTIIFDKIDILPEE
-
Nucleotide Sequence: 4476 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2776150-2771675 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAGCGATAACAACGCGGCCCGTAAGGGCGACGAGATTATTCACTCCAGCATTTTTGCTGACATCACCA
GCATTGTGGCGGAAGGTGCCGCCTATGCGGTGATCGGTGCGGCGGTTGGCGCTGCTGCAACCGTAGCGGC
GCCACTGCTGGGGGCGGGGGCCGCGGCAGCAGGCGTGGCGGCAATTGGATCCAGCTGTCTGTTAAGCGGG
ATTATCGGCGGCGTGCTGGCGAACGTGGCAGGGATCACTGACGATATCAGCAATGCCGCGGAAGGGTTGG
GCAATGCGCTTTTCCCTCCGTCGCCTGCGGGCAAAATTACCACCGGTTCGAATAACGTTCTGACGAATGC
GATCCCCGCCGCGCGCGCGGCCGGAACGCTGACGCCTGCGGATACCCCTTCCCCTGAACCGCAGTCTCCG
GGCAGTTTTGCCGATTACGCAGGGATGCTGCTTTCCGCCGCCGGACAATTTGGCAGCGAAATGTGGCAGC
CGAGCGTGGCCTCTGCCGCGGCGGGGACCTCGCCACTGGAAGAAGACAAGGTGGCGTGCGAAAAACACTC
CGGGCCGCAGTATCTGGCGGAAGGCTCCAAAAGCGTCTTTATCAACGGACAGCCTGCGGTGCGCGCGAAA
GATCGCACCACCTGCGAAGGCACCATTTCCGACGATGTCTCCCCGAACGTGATCATTGGCGGCGACACGC
TTACGGTTCGCGATATCAAAAGCGGTAAAACGCCGGGACTGGCGCTGGGGATGATTGCGCTCTCCCTGCT
GCGCGGACGTCCGGGCAAGATTCTGAAAAACATGCCCTGCGCGCTGGCGGCGGCCGGCGGCGGGATGCTG
GCCGATATGGCCGTGAATGCCGTGTTTGGCTCCTCGCATCCGGTTCACGCCGCCACCGGCGTAAAGGTAC
TGAATGACGACGATGAACTCGATTTCTCGCTGCCGGGACGCTTCCCGCTTCGCTGGCAGCGCAGCTATAA
CAGCCTGACCACCCGCGAAGGGCTGTTCGGGCTGGGCTGGGCAACCCCCTTTGACAGCTATCTGACGCTG
GAAGAAAACAACGCCACCTGGTTCGACGAAACCGGGCGTGAGCTGAGCTTCGAGCTGCCGCCTGTCGACC
GCGCGTTTTACAGCATCAGCGAAGGCATCATTATCCGCCGTAATGAAAATGGCGACGTGGCGATAGCTGA
TGACGACGGTGCGGTGTGGCGTCTGTACAAACCAACCCGGGCAAACCCTGCTGTTCTGCGTCTGGCATCT
CTCAGCGACGAATACGGCAACGCGCTGCTGACGACGTGGGATGAGCACGGCAGGCTGGTTGGTCTTCACG
ACGAGCCACGGGCAATAGATGTTACTTTGCGCTATGAAGATGAACGTTTCCCGCAGCGCGTGACGTCGGC
GAGCCATTTCGATGGCAACCGTTCCTGGCCGCTGATGCAGTGGCGCTACGATGCGGGCGGCCAACTGGCG
AGCGCGACAGATGCCTCCGGCGTGGTAACGCGTGAATACCGCTATAACGACCGCGGCCTGATGGTCTGGC
ACCGCCTGCCAGGTGGGCTGGAAAGTGAATACCGCTGGCAAAAATTCGACCACTGGCGCGTGGTGGAAAA
CCGCACCAGCACCGGCGACGGGTGCCGCTTTAGCTATGATTTAGCCGCCGGGCTGACGACCGTCGAGCAC
TACGACGGCCAGACGCGTAAGCACTACTGGAACGCGCAAAATCTGATTGTCCGTTACGTTGACGAGCGCG
GTGAAAACTGGCGCTACGAGTGGGATGACAACGAACTTCTGACCCGTCGCGTCGATCCCCTCGGCAATGC
CGTTACCTTTGTCTACGACGAAATGGGCAACCGGGTGCAGGAGATCGACGCCGACGGCAATACCCGTACC
ACCACCTGGCTGGAGCACCGCGCGCTTCCGGCGGCAATTATCGAAGCCGACGGCAGCGCGACCCGTTTCT
GGTACGACGAACATCACGGCCTGAAGCGCGTGGTCGACCCGATGGGGCAGACCACGCTCCTGCACCGGGA
TGAGTTTGGTCAGGTGGTTGAGGAGGTCGATGCCGCCGGAAACAGCCGCTATCAGGAGTATAACGACGCC
GGGCAGATGGTACGTGCGACGGACTGTTCCGGGCGCATTACCCGCTACCGTTATCATCCGCTCGGCTGGC
TGGTGGCCGAGACTGGCGCCGACGGCGAAGAGACGCGCTATCGCTACGACGCGGCAGGACGTCCGGTACA
GCTCGATCGTCCGGAAGGCTGGACGGAGTCACTTGCATGGAACGAGCGCGGCCTGCCGGTGAAGCATGCG
GGCGCTGACGGAAAAGAAAGCGAGTTCAGATACGATGACGCAGGGCGCTTAACCGCCACCCGCAATACTC
AGGGGGAAGAGGTGCGCCGCCGCTGGGACAGCCGCGGGCGTCTGGTTGCCCTGGAAAACGAAAACGGCGA
AGCGTACCGGTTCCGCTGGGGCGCGGACTCGCTGCTTCTGGAAGAGACAGGGCTTGATGGCGTGGCCTCG
CAGTATCGCTACGACGCCTGCGGGCGTACGATAGCGCGCACGTTTGCCGCCGGTCACCCGGAGGCAATCA
CCCACGCCTTCGCCTGGAGCGCAAGCGGCCAGCTGGTCGCCCGCACCACGCCGGAAGGGCAGACTCGCTA
TCATTACACACCGTCCGGGCTATTAAGCCGGATCGGGCTGCATCCTGAGCTTTCAGCCGACGCGTGGACC
ACCGAGGCCGAGCAGGAGCTTGCCTTTGACTATGACGCGCTCGGTCGCGTGACGCGCGAGGCGGGCGAAC
ACGGCGAGCTGGCGTGGGAGTATGACGCGCTGGGCAACCGCACCTCCCTCACGCTGCCCGATGGCCGCGA
GCTGAAACAGTTCTACTACGGCAGCGGGCATCTGCTCGGCATTGCCCTCGATAAGCTGTCGGTCTCTGAT
TTCACCCGCGACGAACTCCACCGGGAGACCAGCCGCACTCAGGGGCTGCTGACCACCCGCAGCGAGTACG
ACCGTCTCGGTCGACTGCATCGCCGGGATGTCTTCACTGGCAATGCCCAACGCCCGTCGCCGCGCCGCTG
GTCTCGCCGCTGGGATTACGATTACCGCAATAACCTGGTGCGGGAAGAGCGGGACGATAATCCGTTCAGC
TGGTACCGCTGGCAGTATGACAGCGCCGGGCGCCTGCTGGTTCAGGACGGCTCGCTGCCCGGACAGGAGC
AGTGGCGCTGGGATGCCGCCGGTAACCCGCTGGAAGACTCTGCTGAGAAGGTCACGCATAACCGCCTGAC
GCAGCTGAACGGCATTCGCTGGCGTTATGACATTCACGGCCGCACCGTGGAGAAGGATAACGGCCAGACC
CGGTGGCACTACCGCTACGACGGCGAGCACCGCCTGACGGAGGTCATCAGCCAGCCGCGGGATCGCAACA
AACCGCAGACGCAGGTCAACTTCCGCTACGATCCGCTCGGACGACGGATCAGCAAAACGCGTCGCCAGAT
GCTGGGCGGGCAGCCAACCGGCAAGCCGGTCACTACCCGTTTTGTCTGGGAGGGGTTCCGCCTGCTGCAG
GAATTGCACGGGGATGTGCCGCTGACCTACGTCTACAGCGATCAGGACAGCTACGATCCGCTGGCGCGTA
TCGACGGCGTGGTTGCCCCGGAAATCTTCTGGTTCCACTGTCAGCCCAACGGCACGCCGGAGCGGATGAC
GGATATCGAAGGGCAGGTGCGCTGGGACGCGGTGAACAGCGCCTGGGGCAAGCTGCTGCGGGAAAGCGAA
ACGCAGGTATCAGGATATTCTCAGAACCTGCGCATGCAGGGTCAATACCTGGATCGTGAGACAGGGCTGC
ACTACAATCTGTTCCGGTATTACGACCCGGACTGCGGAAGGTTTACGCAGCAGGACCCGATAGGGCTGGC
GGGGGGGATAAACCTTTACCAGTATGCGCCGAATGCGCTGGGGTGGGTGGATCCGTGGGGGTTGAGCCGT
GAGTGTAGCGGTAAAACAAAACCTGATTTCTATGTCGGTCCAGCGGGACCAAGCGCTACAATGCCTTCAA
CTGCTTATCGTTATGTTCGATACTTGAATGACGATGGCAGTTTAGATAAATGGGCTCCTGGTCTTCTCGA
AACAAAAAAAGCGCCCGTAACGTATTTTGGATTCGAAAAATTTGAAACGGGTAAAGCGGCTCGTGATGCG
TTTCAGATAAAAGGTCCCGATAAAGTTGATCCGACGTTACCAGCGGATGTCTCTTGGAGTGATGCAAGGA
TTAGAGGAACGTTTGATACATTGCAACTTTACGAAAATGGTACTCCACAAGTGAGGCATCCAAGAATGTT
TGGAGATGAAATTGGTGCACCATTAGAACAATTTACGCATGCCTATCCGCAATACGGAAAGGGGGGCGTA
GAACAAATGCATGCAGAAAAACGGACAATTATTTTCGATAAAATTGATATTCTTCCGGAGGAATAA