SecReT6
Effector Protein ID: 401764107
-
SecReT6 ID686
T6SS typeA3
Gene symbol-
Locus tagECENHK_13195
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]2796139..2796621 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDJ7GJA1
KEGG IDeno:ECENHK_13195
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|401764107|ref|YP_006579114.1| hypothetical protein ECENHK_13195 [Enterobacter cloacae subsp. cloacae ENHKU01]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCASGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTT
AGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c2796621-2796139 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCT
GGACTGATATTACCTCCTTCTCCTGGGGCGCTTCCCAGCCAGGTAATATGAGCGTTGGCGGTGGCGGCGG
TGCCGGTAAAGTAAACTTTAACGATCTGCACGTTAATGCTCTGATCGACAAATCCACCACTGCAATCCTG
AAACACTGCGCCAGCGGTAAACACCTGACCAAAGTTGAACTGTCCGTCTGTAAAGCCGGTGGTCAGCAGG
TGGAATATACCCGCATCACGCTGGAAGATGTGCTCGTGACTTCTGTTCAGTACACCGGTGCAGACAACGG
CGATACCGTTGGTGTGACCTACGCGTTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACCACT
GCCGGTGGTAAAGGTGCTGAAAGCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA