SecReT6
Effector Protein ID: 401764632
-
SecReT6 ID687
T6SS typeA2
Gene symbol-
Locus tagECENHK_15870
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3390129..3390620 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDJ7GKR8
KEGG IDeno:ECENHK_15870
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.80E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|401764632|ref|YP_006579639.1| Hcp1 family type VI secretion system effector [Enterobacter cloacae subsp. cloacae ENHKU01]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPEMYDVKDPSKEKHNHLERVELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3390620-3390129 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGATGGCGGCGCGGACATTAAAGGGTCTGTAGACGTTC
AGGACCGTGAAGGCAGCATCGAAGTGGTGGCTCAGGAACACAACCTGTACATCCCGACCGATAACAATAC
CGGCAAGCTGACCGGGACGCGTATCCACACGCCATTCCTGTTCACCAAAGAAATCGATTCCTCCAGCCCA
TATCTTTATAAGGCTGTGACCACGGGTCAGACCCTGAAGTCTGCGGAATTCAAGTGGTACAAAATCAACG
ACGCGGGCCAGGAAGTGGAGTATTTCAACACCAAACTGGAAAACGTGAAGGTGGTGAAGGTGAATCCTGA
AATGTATGACGTTAAGGATCCTTCTAAAGAGAAGCACAACCACCTTGAGCGCGTTGAACTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGACTCCTGGAACGAACGCGCTACTGCGT
AA