SecReT6
Effector Protein ID: 401765322
-
SecReT6 ID687
T6SS typeA2
Gene symbol-
Locus tagECENHK_19370
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]4134597..4135082 [+]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDJ7GMQ1
KEGG IDeno:ECENHK_19370
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-33, Aligned region: 12..144
Protein Sequence: 161 a.a.     [Download]
>gi|401765322|ref|YP_006580329.1| Hcp family type VI secretion system effector [Enterobacter cloacae subsp. cloacae ENHKU01]
MAVPVHIWFYDDGGSLIKGSCDVQDREGSVEIRGLTHNLSIPTDPLSGRLTGTRKHAPFLFEKEIDSSSP
YLYKAVATGQNLKKVEIRYYRINNAGWEVEYFRTELEGVKVVSISPIVNDTRNCPGTGHLESVQLRYEKA
TWTYCDGNIQFSDAWNERASA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|401761514|ref|NC_018405.1|:4134597-4135082 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGCCGTACCTGTTCACATTTGGTTCTATGACGACGGTGGCTCACTCATTAAAGGTTCATGTGATGTTC
AGGATCGTGAAGGGAGTGTTGAAATTAGAGGTTTAACCCATAACTTGAGTATTCCAACCGATCCACTCTC
CGGAAGATTAACCGGAACGAGGAAACACGCGCCTTTTTTATTCGAGAAGGAAATTGATAGCTCATCTCCC
TATCTTTATAAGGCGGTAGCGACAGGGCAAAACCTTAAGAAAGTTGAGATTAGATATTACCGAATCAATA
ACGCAGGTTGGGAGGTTGAATACTTTAGAACTGAGCTGGAAGGTGTGAAAGTTGTCTCTATTTCGCCTAT
TGTTAACGATACTCGTAACTGTCCAGGTACTGGCCACCTTGAATCTGTTCAATTGCGCTATGAAAAAGCG
ACCTGGACCTATTGCGACGGGAATATTCAATTCTCTGATGCATGGAACGAACGGGCATCAGCATGA