SecReT6
Effector Protein ID: 402566842
-
SecReT6 ID688
T6SS typeA4b
Gene symbol-
Locus tagGEM_2076
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]2264523..2267327 [-]
Productrhs element vgr
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDJ7JB26
KEGG IDbct:GEM_2076
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-62, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 3.30E-62, Aligned region: 518..636
DUF2345 [PF10106], Evalue: 1.40E-38, Aligned region: 558..581
DUF2345 [PF10106], Evalue: 1.40E-38, Aligned region: 740..903
T6SS_Vgr [PF13296], Evalue: 2.50E-24, Aligned region: 590..690
T6SS_Vgr [PF13296], Evalue: 2.50E-24, Aligned region: 789..820
Phage_base_V [PF04717], Evalue: 5.10E-11, Aligned region: 102..125
Phage_base_V [PF04717], Evalue: 5.10E-11, Aligned region: 442..543
Protein Sequence: 934 a.a.     [Download]
>gi|402566842|ref|YP_006616187.1| rhs element vgr [Burkholderia cepacia GG4]
MSTQSDLIQAFFGGRSQHDRFLWLTTPLGADKLVAESLHGWESLDRGGFRFQVTALTERPDVPLDKLIGA
PILVEWQAADGQDARRPFHGHVTAAELVGYNGGLARVRLVVEPWLALLQQRVDSYNFVNASVVDISEQIF
AHYARGAIVPAWRWALADPAKYAKRSLTAQAGEADFAFLERLWAEEGIFYWFEHEGDAHSASLGKHTLVL
SDTNERFAPAEPERVGFHQTSDGDPRGGIRQFLNARRWRIGSVARASWDHRSLSTRPAGVRATGAAVPGE
DRDVAGPYAFQTAAIGDQRAQQQLDAQRVAALQAEGSGTRRDLRPGLRFAMSNHPSLDASHAFVCLRVEH
DARANVGADVHGAIAQRLGGIPPLLDATPGGYGSAQALHAAFDATTHDGGALMDGDEVYRNRFAALPFDQ
AYRPLAPDGHGARVHPVAVMPGPQTTIVVGAGDPLHTERDHRIRIQHHAQRGQNSASREDHPRTANAPAD
RGAGTWTRMVTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGQGNTDAQHNALAGGPSSST
ANAAAWFAGNDHAAVLTGFKTQDMSASQTGAAGSRQFMLDDTAGQASARLATTDHDSGLTLGHIKQVQDN
RRLADRGYGAELSTQAAGALRAGAGLLISTAPGVNQMDASAASQVLAQQREMLQGLADFARKQGAEPGAS
AAQPGTAAAGGATPPLAAIDGLQQSQASIGATREGSGAGGAGGGGAVAWKHPHLVAHGAAGVAALTAQSH
VWTSGTQTVLSAGRDVQVTVQGKSSIVAKEGIALYTHGTAGGSRPVPAAGIALHAATGAVTVQAQNAGTL
DANAQRTVTVSSAQASVVLQSPKRLLLTAANAFLKMEGNDIVIGAPGKATFHAAQHTLTGPRSANVQLPS
MNKPACVECMRDLAHRHEAIATRG
-
Nucleotide Sequence: 2805 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c2267327-2264523 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGTCGACCCAATCTGATCTCATCCAGGCATTTTTCGGCGGCCGGTCGCAGCACGACCGGTTTTTGTGGC
TGACCACGCCGCTCGGCGCGGACAAGCTCGTCGCCGAGAGCCTGCACGGATGGGAGTCGCTCGATCGCGG
CGGCTTCCGGTTCCAGGTCACCGCGCTGACCGAGCGTCCCGACGTGCCGCTCGACAAGCTGATCGGTGCG
CCGATCCTCGTCGAATGGCAGGCCGCGGACGGGCAGGACGCAAGGCGCCCGTTCCACGGCCACGTGACCG
CCGCCGAACTCGTCGGCTACAACGGCGGGCTCGCGCGCGTGCGGCTCGTGGTCGAACCGTGGCTCGCGCT
GCTGCAACAACGCGTCGACAGCTACAACTTCGTGAACGCGAGCGTCGTCGACATCAGCGAGCAGATCTTC
GCGCACTACGCGCGTGGCGCGATCGTGCCGGCGTGGCGCTGGGCGCTCGCCGACCCCGCCAAATACGCGA
AACGCAGCCTGACCGCGCAGGCCGGCGAAGCGGACTTCGCGTTTCTCGAACGACTGTGGGCCGAAGAAGG
CATCTTCTACTGGTTCGAACATGAAGGCGACGCGCACTCGGCGAGCCTCGGCAAGCACACGCTCGTCCTC
AGCGACACGAACGAGCGGTTCGCGCCCGCTGAACCCGAACGCGTCGGCTTCCATCAGACGAGCGACGGCG
ATCCGCGCGGCGGTATCCGGCAGTTCCTGAACGCACGCCGTTGGCGCATCGGCAGCGTCGCGCGCGCGAG
CTGGGATCATCGCAGCCTGTCGACGCGTCCGGCCGGCGTGCGCGCGACCGGCGCGGCGGTGCCGGGCGAG
GATCGCGATGTCGCCGGCCCGTACGCGTTCCAGACCGCCGCGATCGGCGACCAGCGCGCGCAGCAGCAAC
TCGATGCACAGCGCGTGGCGGCGTTGCAGGCCGAAGGCAGCGGCACGCGTCGCGATCTGCGCCCGGGGCT
GCGCTTCGCGATGTCGAATCATCCGTCGCTCGACGCATCGCACGCGTTCGTGTGCCTGCGCGTCGAGCAC
GACGCGCGGGCGAACGTGGGCGCCGACGTGCACGGCGCGATCGCGCAACGGCTCGGCGGAATTCCGCCGC
TGCTCGATGCCACGCCCGGCGGGTACGGCAGCGCGCAGGCGCTGCATGCGGCGTTCGACGCGACGACGCA
CGACGGCGGCGCGCTCATGGACGGCGACGAGGTGTACCGGAACCGCTTCGCCGCGTTGCCGTTCGACCAG
GCCTATCGGCCGCTGGCGCCGGACGGACACGGTGCGCGCGTGCATCCGGTCGCGGTGATGCCCGGCCCGC
AGACGACGATCGTGGTCGGCGCGGGCGACCCGCTCCATACCGAGCGCGATCACCGGATCCGGATCCAGCA
TCACGCGCAGCGCGGACAGAATTCGGCGAGTCGCGAGGACCATCCGCGCACCGCGAATGCGCCGGCCGAT
CGCGGCGCCGGCACCTGGACGCGCATGGTGACGCCGGTGGGCGGCGACAACTGGGGCGGCGTGAGCGTGC
CGCGCGTCGGCCAGGAAGTCTGGACCGAATGGCTCGAAGGCCAGCCGGACCGGCCGGTCGCGGTCGCCGC
GCTCTATAACGGGCAGGGCAACACGGATGCGCAGCACAATGCGCTGGCGGGCGGTCCGAGCAGCAGCACG
GCCAACGCGGCGGCGTGGTTTGCCGGCAATGACCATGCGGCCGTGCTGACCGGTTTCAAGACGCAGGACA
TGAGCGCGAGTCAGACCGGTGCGGCCGGCTCGCGTCAATTCATGCTCGACGACACGGCCGGCCAGGCGAG
TGCGCGCCTGGCCACGACCGATCACGACAGCGGCCTGACGCTCGGGCACATCAAGCAGGTGCAGGACAAC
CGGCGTCTGGCCGATCGCGGCTACGGCGCCGAACTGTCGACGCAGGCGGCCGGTGCGCTGCGCGCTGGCG
CCGGTTTGCTGATCAGCACGGCGCCCGGCGTGAACCAGATGGACGCGAGCGCCGCGAGCCAGGTGCTCGC
GCAGCAACGCGAGATGCTGCAGGGGCTCGCGGATTTCGCGCGCAAGCAGGGCGCGGAGCCGGGCGCGAGC
GCGGCGCAGCCCGGTACGGCAGCCGCCGGCGGCGCGACGCCGCCGCTCGCCGCCATCGACGGGTTGCAGC
AGAGCCAGGCGTCGATCGGCGCGACGCGCGAAGGCAGCGGCGCGGGCGGTGCCGGCGGCGGCGGTGCGGT
TGCGTGGAAGCATCCGCATCTCGTCGCGCACGGTGCGGCCGGCGTCGCCGCGCTGACGGCGCAGAGCCAC
GTCTGGACCTCGGGTACGCAAACCGTGCTGAGTGCCGGACGCGACGTGCAGGTCACGGTCCAGGGCAAGT
CGAGCATCGTCGCGAAGGAAGGCATCGCGCTGTACACACACGGCACGGCGGGCGGCAGTCGCCCGGTGCC
GGCCGCCGGCATCGCGCTGCACGCGGCGACGGGCGCCGTCACCGTGCAGGCGCAGAACGCCGGGACGCTC
GACGCCAATGCGCAGCGCACGGTGACGGTGTCGAGCGCGCAGGCGAGCGTCGTGCTGCAGTCGCCGAAGC
GGCTGCTGCTGACGGCCGCCAACGCATTCCTGAAGATGGAAGGCAACGACATCGTGATCGGCGCACCGGG
CAAGGCGACCTTCCATGCGGCCCAGCACACGCTGACCGGCCCGCGTTCCGCGAACGTGCAGTTGCCGTCG
ATGAACAAGCCCGCGTGCGTCGAATGCATGCGGGATCTCGCGCATCGCCACGAAGCGATCGCCACGCGCG
GGTGA