SecReT6
Effector Protein ID: 402566846
-
SecReT6 ID688
T6SS typeA4b
Gene symbol-
Locus tagGEM_2080
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]2270338..2274066 [-]
Productrhs element vgr
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDJ7J2T3
KEGG IDbct:GEM_2080
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-52, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 5.70E-52, Aligned region: 698..755
DUF2345 [PF10106], Evalue: 7.40E-47, Aligned region: 667..819
T6SS_Vgr [PF13296], Evalue: 2.10E-29, Aligned region: 516..623
Phage_base_V [PF04717], Evalue: 3.00E-15, Aligned region: 384..496
Phage_base_V [PF04717], Evalue: 3.00E-15, Aligned region: 1133..1154
Protein Sequence: 1242 a.a.     [Download]
>gi|402566846|ref|YP_006616191.1| rhs element vgr [Burkholderia cepacia GG4]
MDLVAALTGYGQATRHIQIDTAMPGAFVVERFHGREGVSESFRFEIDVLSSEPFLDLAPLIGSAARLRLA
TAAGERCWNGYVTHAAYAESDGEFTRYRLTMESWLALLQLRRNCLYFVDLDAEGICERVFGDYPEAHRRY
ELVEPLRSFRLRGQYRETDLDFVLRQLSEAGLSFRIEHGQEAGKAPSGDHTVVVFDRHARLPDGSVIAFN
AQDVGDPDGVMTQFSDRRQLVPDRVVATSWKASELHALAGQAQQPADTDAPVLPVREIFDGQRAGRFDTS
GDAQRYAEQRLDALQLAKRIHHGGGSSRTLEIGKVHTLNDYLGRTVRFVPLSIEHEAVNNLGAQIGQLFG
RGELDKGLYRNRFVAVPEGTPIVPPFRDRPTVHGVQTAIVVGEPGGRVSSTRDHQVRIQFPWMRGVAPLP
GGLTDTASRSNPAGHAPGDHRSGIVVRVAEQAAGPNFGHAFTPRVGTEVVVGFESGNIDSPVVLGQVYGG
RVRPPFSAGEGSDANHSGSLTGLQTQTLDGQPGSRWVMDDAAGQLRHELNNSTAGTRLAQGYLIDQQGTM
RGAYRGEGFELATQGWGVVRAGAGVLMSSTARTLGASTQLDVAERVEQLKDAANTAQELDKAATGAQAVG
LTANAAQSDFLKAIDPAQDGKYAGSVSGQSATKPNGTQRDGGDPVERFATPAVLMESPENIVVTTPDSAV
SYAAQHVHLTSQGDAHVGAGATVAAATGDAMSVYSVAGGLKAIAGEGPVSVEAHASTMEILADQTVRVTS
TDERVDVLAQDAIVLQQGPNRITLKGGDIIVETPGQFTVKAGGHPFPGPLAASVKLPALPVLPQGDPCDF
LVQALAASPAGRGAVASGGSAAGAALWGGAASGATALVAGIPVSGAGTLPLVPQAFADESSRSMPAPVPA
SSGQNAAPGPSLGHSTPPPVSSELEGMPKKGPAAQSGPCNLHVPAIQQELHTVDAGCVDYFQTGADGTPV
LKDKKRIWLKFSGTKDSYDIGYAPATATVTATVYIKVNLKDQYWINNGSVYMDPSTGKPFSVPFNSDGIR
KDRVMRIVDRPGGLGPILGFKKRIEDGLNKGNYSMQPKACPLGRACTCKVKLKLEVELVQIGRCHAEVNL
YPLVTRANSANWGEVQVEWDDQQKRYVPVSTQHALVHETGHLFGWPDEYFLDGGAVFGKYINSRNLVDVK
MAQLDDNWQRTTETNLMGGGMLTEKPEIPKYYMYGFRDWFNKKTGIDWEVLK
-
Nucleotide Sequence: 3729 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c2274066-2270338 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGGATCTTGTTGCAGCATTAACGGGTTACGGGCAAGCGACCCGTCATATCCAGATCGATACCGCGATGC
CGGGCGCATTCGTGGTCGAGCGTTTTCACGGTCGTGAAGGGGTCAGCGAATCGTTCCGGTTCGAGATCGA
TGTGCTGTCGAGCGAGCCGTTTCTCGATCTCGCGCCGCTGATCGGCAGCGCCGCGCGGCTGCGTCTCGCG
ACGGCGGCGGGCGAGCGTTGCTGGAACGGTTACGTCACGCATGCCGCTTATGCGGAGAGCGACGGCGAGT
TCACGCGCTACCGGCTCACGATGGAATCGTGGCTCGCGCTGCTGCAGCTGCGCCGCAATTGCCTGTATTT
CGTCGACCTCGATGCCGAGGGCATCTGCGAGCGCGTGTTCGGCGACTATCCCGAAGCGCACCGGCGCTAT
GAACTCGTCGAGCCGCTGCGATCGTTTCGCTTGCGCGGCCAGTATCGCGAGACCGATCTGGATTTCGTGC
TGCGCCAGTTGTCGGAGGCCGGGTTGTCGTTTCGCATCGAGCACGGGCAGGAGGCGGGGAAGGCGCCGTC
GGGCGACCATACCGTCGTCGTGTTCGATCGCCATGCGCGGCTGCCCGACGGCAGTGTCATCGCGTTCAAT
GCGCAGGATGTCGGCGATCCGGACGGCGTGATGACGCAATTCTCCGACCGGCGTCAGCTCGTGCCGGATC
GCGTGGTCGCGACCAGCTGGAAAGCCAGTGAACTCCATGCGTTGGCCGGCCAGGCGCAGCAGCCGGCCGA
CACCGACGCGCCGGTGCTGCCGGTGCGGGAGATCTTCGACGGCCAGCGCGCCGGCCGCTTCGACACGAGC
GGCGACGCGCAGCGTTACGCCGAGCAGAGGCTCGACGCGCTGCAGCTCGCGAAGCGGATTCACCATGGCG
GCGGGTCGTCGCGCACGCTCGAGATCGGCAAGGTCCATACGCTGAACGATTATCTGGGCCGCACCGTCCG
GTTCGTGCCGCTGTCGATCGAGCACGAGGCCGTGAACAACCTCGGCGCGCAGATCGGGCAACTGTTCGGG
CGCGGCGAGCTCGACAAGGGCCTGTATCGCAATCGCTTCGTCGCGGTGCCGGAAGGCACGCCTATCGTGC
CGCCGTTCCGCGACCGGCCGACCGTGCATGGCGTGCAGACCGCGATCGTCGTCGGCGAGCCGGGCGGGCG
CGTCAGCAGCACGCGCGATCACCAGGTGCGCATCCAGTTTCCGTGGATGCGCGGCGTTGCGCCGTTGCCG
GGCGGGCTGACCGATACGGCGAGCCGGTCCAATCCGGCCGGCCATGCGCCGGGCGATCATCGCTCGGGCA
TCGTGGTGCGTGTCGCCGAACAGGCCGCCGGCCCGAATTTCGGTCATGCGTTCACGCCGCGCGTGGGGAC
GGAAGTGGTGGTCGGCTTCGAGTCGGGCAACATCGATTCGCCGGTCGTGCTCGGCCAGGTGTACGGCGGC
CGGGTGCGCCCACCGTTCTCCGCGGGCGAAGGCAGCGACGCGAACCATTCAGGATCGCTGACGGGCCTGC
AGACGCAGACGCTCGACGGGCAACCGGGCAGCCGCTGGGTAATGGACGACGCCGCTGGCCAGTTGCGTCA
CGAGCTGAACAATTCGACTGCCGGCACGCGCCTCGCGCAGGGCTATCTGATCGACCAGCAGGGCACGATG
CGCGGCGCTTATCGCGGCGAAGGCTTCGAACTGGCGACGCAGGGATGGGGCGTCGTGCGGGCCGGGGCCG
GCGTGCTGATGTCGAGTACCGCGCGAACGCTCGGTGCGTCGACGCAGCTGGATGTCGCCGAGCGCGTGGA
GCAGTTGAAGGACGCGGCGAACACCGCGCAGGAACTCGACAAGGCGGCCACCGGCGCGCAGGCGGTCGGC
CTGACCGCGAATGCGGCGCAGTCGGATTTCCTGAAGGCGATCGATCCCGCGCAGGACGGCAAGTATGCGG
GGAGCGTGAGCGGCCAGAGCGCGACCAAGCCGAACGGGACGCAACGCGACGGCGGCGATCCCGTCGAGCG
CTTCGCGACGCCTGCGGTGCTGATGGAGTCGCCGGAGAACATCGTGGTGACGACGCCGGATAGCGCGGTG
TCGTATGCGGCGCAGCATGTTCATCTGACGTCGCAAGGCGATGCGCATGTGGGCGCAGGGGCGACCGTGG
CGGCGGCGACTGGCGACGCGATGAGCGTCTACAGCGTGGCAGGCGGGCTCAAGGCGATCGCGGGCGAAGG
GCCGGTGAGCGTTGAGGCGCATGCGTCGACGATGGAGATTCTCGCGGACCAGACCGTGCGCGTGACGTCG
ACCGACGAACGCGTCGATGTGCTCGCGCAGGATGCGATCGTGCTGCAGCAGGGGCCGAACCGGATCACGC
TGAAGGGCGGCGACATCATCGTCGAGACGCCGGGGCAGTTCACGGTGAAGGCAGGCGGGCATCCGTTCCC
GGGGCCGCTGGCGGCGAGCGTGAAGCTGCCGGCGCTGCCAGTGTTGCCGCAGGGGGATCCGTGTGATTTT
CTCGTGCAGGCGCTGGCGGCGAGTCCGGCGGGGCGTGGGGCGGTGGCGTCGGGGGGGAGTGCGGCGGGTG
CGGCGCTATGGGGCGGGGCAGCGTCGGGCGCGACGGCGTTGGTGGCGGGCATACCGGTCTCGGGAGCAGG
AACCTTGCCGCTTGTCCCGCAGGCATTTGCAGATGAGTCGAGTCGATCCATGCCTGCACCGGTACCCGCA
TCATCGGGACAGAATGCGGCGCCCGGCCCGTCGCTCGGTCATTCGACTCCGCCGCCGGTTTCCAGCGAAC
TGGAAGGCATGCCGAAGAAAGGCCCGGCTGCGCAAAGCGGGCCGTGCAATCTTCACGTCCCTGCCATCCA
GCAAGAGCTCCATACGGTCGATGCAGGATGCGTCGACTATTTCCAGACGGGAGCGGACGGCACGCCGGTG
CTCAAGGACAAGAAACGAATCTGGCTGAAATTTTCCGGCACGAAGGATTCGTACGATATCGGATACGCAC
CCGCGACGGCGACCGTGACGGCGACCGTCTATATCAAGGTCAACTTGAAGGACCAGTACTGGATCAACAA
CGGGAGCGTCTACATGGATCCATCGACCGGCAAGCCGTTCTCGGTGCCGTTCAATAGCGATGGAATCCGT
AAAGACAGAGTGATGAGGATCGTGGACCGGCCGGGTGGGCTGGGTCCCATATTGGGCTTCAAGAAACGCA
TCGAGGACGGGTTGAATAAAGGGAACTATTCGATGCAGCCAAAGGCATGCCCGCTTGGTCGTGCATGCAC
GTGCAAGGTCAAGCTGAAACTGGAAGTCGAACTGGTTCAAATCGGACGATGCCATGCGGAGGTCAATCTC
TATCCGTTGGTAACGCGGGCGAACTCGGCGAATTGGGGGGAAGTGCAAGTCGAGTGGGACGACCAACAGA
AGCGGTATGTCCCGGTGTCGACCCAGCATGCACTCGTGCATGAGACCGGGCATCTGTTCGGCTGGCCAGA
TGAGTACTTTCTTGACGGCGGCGCCGTGTTCGGAAAGTACATCAATTCACGAAATCTGGTCGACGTGAAA
ATGGCGCAACTTGACGACAACTGGCAGCGCACGACCGAGACGAACTTGATGGGCGGCGGAATGCTCACGG
AAAAACCGGAAATTCCGAAGTACTACATGTATGGTTTCCGTGATTGGTTCAACAAAAAAACCGGAATTGA
CTGGGAAGTGCTGAAATGA