SecReT6
Effector Protein ID: 402566847
-
SecReT6 ID688
T6SS typeA4b
Gene symbol-
Locus tagGEM_2081
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]2274128..2276527 [-]
Productsecreted protein hcp
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDJ7JB30
KEGG IDbct:GEM_2081
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 2.30E-54, Aligned region: 42..138
DUF2235 [PF09994], Evalue: 2.30E-54, Aligned region: 260..281
DUF2235 [PF09994], Evalue: 2.30E-54, Aligned region: 285..409
Protein Sequence: 799 a.a.     [Download]
>gi|402566847|ref|YP_006616192.1| secreted protein hcp [Burkholderia cepacia GG4]
MSFRFASADRQDVGVVTKAEQDAIMRRLHDDDGMSCCKTLHVGIFFDGTRNNADRDRSGGKHSNVARLFD
VFPRDKYHSAIYVAGVGTPFVDEIGDQGVGLQAAAGAAAGWAGEGRINWALLQLHNVVHALAFGNSLSAA
LGKSDKALAKAVSVDLNFKGIDLGGTPPKPGSLGDINARGSSSVGALKLMAAEQNGIELTWDRDTLWAQL
KGEVDTANWTATMRAWDEKRRTALRARCAQLKERVGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWL
ADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQGTAATLFDGHGGWGRKELMGVPYYVRRCVHMVAAHEP
RGSFPLDLIDASLDGREEIVYPGVHSDVGGGYGPGEQGRGTGDADKLSQVPLLDMYREARKAGVPLDIKG
PGVAAEAAAAFAISPGLKRAFSAYVSTSADYYYAKEHGTPGLMRAHYGLYLRWRKMRLDNLRTQPSFLAA
KAAYPQDAVDLDSANEELRLEWRDLLECEKEGGPTVSRYAGNAVSRKITQNPKAAAVISPAVLPIAAGLQ
SAIPFVGPVVRASAKRAEDFFQLQLDEKWQQWLEVRGDWNMGPPEAPISALYDNFMHDSRAWFKPLGDDD
DVWNHNQIKALQTRQAEFERQHAEWKKRQQLGVPGPSQIMQMMGAGALGLGPAANIAPEPEPRSPLTAQQ
ADILKRYDAAQRAAQNARAARDATAPTDSAVLTDPKVTGGLALQDAGREFSFVWGYLRWRTVYVNGVRWD
APHVPTVQEDMEAMRQQMQRNVDMSKLFR
-
Nucleotide Sequence: 2400 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c2276527-2274128 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGAGCTTCCGATTCGCGAGCGCGGACCGGCAGGACGTCGGGGTCGTGACCAAGGCGGAGCAGGACGCGA
TCATGCGCCGGCTCCACGACGACGACGGGATGAGCTGCTGCAAGACGCTGCATGTCGGCATCTTCTTCGA
CGGCACGCGCAACAACGCCGATCGCGATCGCTCGGGCGGCAAGCACAGCAACGTCGCGCGTCTGTTCGAC
GTGTTTCCGCGCGACAAGTATCACAGCGCGATTTACGTGGCGGGCGTCGGTACACCGTTCGTCGACGAGA
TCGGCGACCAGGGCGTCGGCCTGCAGGCCGCGGCGGGTGCCGCGGCGGGATGGGCCGGCGAGGGCCGCAT
CAACTGGGCACTGCTGCAGCTGCACAACGTCGTGCATGCGCTCGCGTTCGGCAATTCGCTGTCCGCGGCG
CTCGGCAAGAGCGACAAGGCGCTCGCGAAGGCCGTCAGCGTCGACCTGAATTTCAAGGGCATCGATCTCG
GCGGCACGCCGCCGAAGCCGGGCAGCCTCGGCGACATCAACGCGCGCGGCAGTTCGAGCGTCGGCGCGCT
CAAGCTGATGGCGGCCGAGCAGAACGGCATCGAGCTGACCTGGGACCGCGACACGCTCTGGGCGCAGCTC
AAGGGCGAGGTCGATACCGCGAACTGGACCGCGACGATGCGTGCGTGGGACGAGAAGCGGCGCACCGCGC
TGCGGGCCCGCTGCGCGCAACTGAAGGAGCGCGTGGGCGATCTGCTGGTCAAGGGCAAGCCGAAGCTGCA
GCGCATCCGCCTGTACGTGTTCGGTTTCTCGCGCGGTGCGGCCGAGGCCCGCACGTTCTCGAACTGGCTG
GCCGATGCGCTGGACCCCGATTTCAGCCTGTGCGGCGTACCCGTGTCGTACGACTTTCTCGGCATCTTCG
ATACGGTCGCGTCGGTCGGCATCGCGCAGGGCACCGCCGCGACGCTGTTCGACGGGCATGGCGGCTGGGG
GCGCAAGGAACTGATGGGGGTACCGTACTACGTGCGCCGTTGCGTCCACATGGTCGCCGCCCACGAGCCG
CGCGGATCGTTCCCGCTCGACCTGATCGATGCGTCGCTGGACGGGCGCGAGGAGATCGTCTATCCGGGCG
TGCATTCGGACGTCGGCGGCGGTTACGGGCCGGGCGAGCAGGGGCGAGGCACCGGCGATGCGGACAAGCT
GTCGCAGGTGCCGCTGCTCGACATGTATCGCGAAGCGCGCAAGGCCGGCGTTCCGCTCGATATCAAGGGG
CCCGGTGTCGCGGCCGAAGCGGCGGCGGCGTTCGCGATTTCTCCTGGACTCAAGCGGGCGTTTTCGGCGT
ACGTGAGCACGAGCGCGGACTACTACTATGCAAAGGAGCACGGCACACCGGGCCTGATGCGCGCGCACTA
TGGGCTTTACCTGCGCTGGCGCAAGATGCGGCTCGACAACTTGCGTACGCAACCGTCGTTTCTCGCCGCC
AAGGCCGCCTATCCGCAGGATGCGGTCGATCTCGACAGCGCGAACGAGGAGCTGCGGCTCGAATGGCGCG
ACCTGCTCGAATGCGAGAAAGAAGGCGGCCCGACCGTGAGCCGATACGCGGGCAACGCGGTCAGCCGGAA
GATCACGCAGAACCCGAAGGCGGCGGCCGTCATTTCGCCGGCCGTCCTGCCGATCGCCGCGGGCCTGCAG
TCCGCGATTCCGTTCGTCGGCCCGGTGGTGCGCGCAAGTGCCAAGCGCGCCGAGGATTTCTTCCAGCTGC
AGCTCGACGAGAAATGGCAGCAGTGGCTCGAGGTGCGGGGCGACTGGAACATGGGGCCGCCGGAAGCGCC
GATCAGTGCGCTGTACGACAACTTCATGCATGACTCGCGCGCGTGGTTCAAGCCGCTTGGCGACGACGAC
GACGTGTGGAACCACAACCAGATCAAAGCGCTGCAAACCCGCCAGGCCGAGTTCGAGCGCCAGCATGCCG
AGTGGAAGAAGCGTCAGCAACTCGGCGTGCCTGGACCGTCACAGATCATGCAGATGATGGGGGCGGGCGC
GCTCGGCCTCGGGCCGGCCGCCAACATTGCGCCGGAGCCCGAACCGCGTTCGCCGCTGACCGCACAACAG
GCCGACATCCTGAAACGCTACGACGCCGCGCAGCGGGCCGCGCAGAATGCCCGCGCGGCACGGGATGCAA
CCGCGCCGACCGACAGCGCCGTCCTGACCGACCCGAAAGTCACCGGCGGTCTCGCGCTGCAGGATGCGGG
GCGCGAGTTCTCGTTCGTCTGGGGCTACCTGCGCTGGCGCACCGTCTACGTGAACGGCGTGCGCTGGGAT
GCGCCGCACGTGCCGACCGTGCAGGAAGACATGGAGGCGATGCGCCAGCAGATGCAGCGCAACGTCGACA
TGAGCAAGCTGTTCCGATGA