SecReT6
Effector Protein ID: 402566850
-
SecReT6 ID688
T6SS typeA4b
Gene symbol-
Locus tagGEM_2084
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]2278097..2280892 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDJ7JC48
KEGG IDbct:GEM_2084
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-50, Aligned region: 37..355
Phage_GPD [PF05954], Evalue: 1.30E-50, Aligned region: 689..741
DUF2345 [PF10106], Evalue: 8.00E-42, Aligned region: 739..899
T6SS_Vgr [PF13296], Evalue: 2.40E-31, Aligned region: 578..683
T6SS_Vgr [PF13296], Evalue: 2.40E-31, Aligned region: 782..805
Phage_base_V [PF04717], Evalue: 5.60E-18, Aligned region: 422..518
DUF2917 [PF11142], Evalue: 0.00082, Aligned region: 229..254
DUF2917 [PF11142], Evalue: 0.00082, Aligned region: 436..454
DUF2917 [PF11142], Evalue: 0.00082, Aligned region: 788..801
DUF2917 [PF11142], Evalue: 0.00082, Aligned region: 862..898
Protein Sequence: 931 a.a.     [Download]
>gi|402566850|ref|YP_006616195.1| VgrG protein [Burkholderia cepacia GG4]
MSVITEFASLFGAFNRLYSLDGAGALAAFQIERWTGRESLSDLFQWNVDALSTDPALDLDALLGQRAAIR
TTLANGTTTVRSGLVAEAECVGYDAGLARYHLQIVPWLAALTHARDERTFVNQTLADVLDTVFAPYATIA
RWRLTPDASRRLEALGPGAYRVQYRTHTHYEFVQHLLADAGLGFCFVEDEDAPAGHTMLVFDDSAQLAED
DTSARRGGVPRRSSGTATDTDDVILGIGQSLSLTADRVTLISSDYRANQATTASANLGRPNGARELYDDV
GPEAFDTLREAEDTARRQVDAIVSRASFWTGYGTLRTARAGRALKLVDSGWQAVRGAAAPEDFLVTRVEH
VGINNLPATVMAAIERQLGPLPAAALDPRVLGQAKVGGYANRFDAVPRTQVWRPTLADGTGQRLNPVPTA
LGAQTAIVVGPTGDAQPGATGPVHADAQGRLRVRFHWQAQDDAGTYPTRAIQRLASDGHGLQQVPRIGHE
VLVQFHHGLVHRPIVLGGLFNGRGEGGESPSPGGAAGQPLDATVYTQASDHAPSAQGNLASGHSPAWHGA
GGGAEHHNHAGALSGFKSQGFDGQGHNQLVADDTDGMGRLQMATTHAATQLNLGHLRHQSDNYLGSFRGQ
GVELRSDAYGAMRATRGLLVSSYAPAGAAQPAGDASALQALLARHVALVGRFDKTTDTHRTLPFAAQRGV
EQAGQSSLNGSAAPLDALAQSFATTVGANGYAQASADAAQRSTGNALPHTGDAVLGIEAQGGHGLIAGQA
LQWAAGETLSLGSGADFNLAAAQQLRVHSGQGIGWLAGASHASGVGMSVIAGKDGLTLQAQRDVLGLRAR
DDLKIASASADVEIAAKKTVHLAVSGGAHVTIEGGDVTFGCPGKFVVYAAQHAFVGPDQMNPPLPQFPEK
VCVECLLHAMQSGSALAGKAI
-
Nucleotide Sequence: 2796 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c2280892-2278097 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGAGCGTCATCACGGAATTTGCGTCTCTGTTCGGCGCATTCAATCGCCTGTATTCGCTGGACGGAGCCG
GTGCGCTTGCTGCATTTCAAATCGAGCGCTGGACCGGTCGCGAATCGCTCTCCGATCTGTTTCAGTGGAA
CGTCGATGCGCTGTCGACGGATCCCGCCCTGGATCTCGACGCGCTGCTGGGGCAGCGCGCCGCGATTCGC
ACCACGCTGGCGAACGGAACGACGACCGTGCGCAGCGGACTCGTCGCCGAGGCCGAGTGCGTCGGTTACG
ACGCGGGCCTCGCTCGCTACCATCTTCAGATCGTGCCGTGGCTCGCGGCACTCACGCATGCGCGCGACGA
GCGGACCTTCGTGAACCAGACGCTCGCCGACGTGCTCGACACGGTGTTCGCGCCCTACGCAACGATCGCG
CGCTGGCGCCTCACGCCGGACGCGAGCCGGCGTCTCGAGGCGCTGGGCCCCGGTGCGTACCGCGTGCAGT
ACCGCACCCATACGCACTACGAATTCGTGCAGCACCTGCTGGCCGATGCAGGCCTCGGCTTCTGTTTCGT
CGAGGACGAGGACGCGCCTGCCGGGCATACGATGCTGGTGTTCGACGACAGCGCGCAACTGGCCGAGGAC
GACACGTCGGCGCGGCGCGGCGGGGTGCCGCGCCGCTCGAGCGGGACGGCGACCGACACCGACGACGTGA
TCCTCGGGATCGGCCAGTCGCTGTCGCTGACGGCCGATCGCGTCACGCTGATCAGCAGCGATTACCGCGC
GAACCAGGCGACGACCGCGAGCGCGAACCTCGGTCGGCCGAACGGCGCGCGCGAGCTCTACGACGACGTC
GGGCCGGAGGCATTCGACACCCTGCGCGAAGCGGAAGACACGGCACGGCGGCAGGTCGATGCGATCGTGT
CGCGCGCGAGTTTCTGGACCGGCTACGGCACGCTGCGCACCGCGCGGGCCGGGCGCGCGCTGAAACTCGT
CGATTCCGGGTGGCAGGCGGTGCGCGGTGCCGCGGCGCCCGAGGATTTCCTGGTGACGCGCGTCGAGCAT
GTCGGGATCAACAATCTTCCCGCGACCGTCATGGCAGCGATCGAGCGGCAGCTCGGACCGTTGCCGGCCG
CGGCGCTCGATCCGCGCGTGCTCGGCCAGGCGAAGGTGGGCGGCTACGCGAACCGGTTCGATGCCGTGCC
GCGCACGCAGGTCTGGCGGCCGACGCTGGCCGACGGAACCGGGCAACGACTCAATCCGGTTCCGACGGCA
CTGGGTGCGCAGACGGCGATCGTGGTCGGCCCGACCGGCGACGCGCAGCCCGGCGCGACCGGGCCGGTGC
ACGCGGATGCGCAGGGGCGCTTGCGCGTGCGTTTCCATTGGCAGGCACAAGACGATGCGGGCACCTATCC
GACGCGCGCGATTCAACGCCTCGCGAGTGATGGCCACGGGCTCCAGCAGGTACCGCGCATCGGCCATGAG
GTGCTCGTGCAGTTTCACCACGGGCTGGTCCACCGGCCGATCGTGCTCGGCGGCCTGTTCAACGGCCGCG
GCGAAGGCGGCGAGTCGCCTTCGCCGGGCGGCGCGGCCGGGCAGCCGCTCGACGCGACGGTCTACACGCA
GGCGAGCGATCATGCGCCGAGCGCGCAGGGCAATCTCGCGAGCGGGCACAGCCCCGCGTGGCACGGCGCC
GGCGGCGGCGCGGAGCACCACAATCACGCCGGCGCGCTGTCGGGCTTCAAGAGCCAGGGCTTCGACGGGC
AAGGCCACAACCAGCTCGTCGCGGACGATACCGACGGCATGGGGCGCTTGCAGATGGCGACGACGCACGC
GGCGACGCAGCTGAACCTGGGCCACCTGCGTCACCAGTCCGACAACTATCTCGGCAGTTTTCGCGGCCAG
GGCGTCGAATTGCGTTCGGACGCTTACGGCGCGATGCGTGCGACGCGCGGCCTGCTGGTGTCGAGCTATG
CGCCCGCGGGCGCGGCCCAGCCTGCGGGCGATGCGTCGGCGCTGCAGGCGCTGCTGGCGCGACACGTCGC
GCTGGTCGGCCGGTTCGACAAGACCACCGACACACACCGGACGCTGCCGTTCGCCGCGCAGCGCGGCGTG
GAGCAGGCCGGCCAGTCGTCGCTGAACGGCAGTGCCGCGCCGCTCGACGCGCTCGCGCAGAGCTTCGCGA
CGACGGTCGGCGCGAACGGCTACGCGCAGGCGTCGGCCGACGCCGCGCAGCGCTCGACGGGCAACGCGTT
GCCGCATACGGGCGACGCCGTGCTCGGCATCGAGGCACAGGGCGGGCACGGGCTGATTGCCGGGCAGGCG
CTGCAATGGGCGGCCGGCGAAACGCTGTCGCTCGGCAGCGGCGCCGACTTCAATCTCGCCGCCGCGCAGC
AGCTGCGCGTTCACAGCGGGCAGGGCATCGGCTGGCTGGCCGGCGCGAGTCACGCCAGCGGCGTCGGCAT
GAGCGTGATCGCTGGCAAGGACGGTCTGACGCTGCAGGCGCAGCGCGACGTGCTCGGCTTGCGCGCGCGC
GACGACCTGAAGATCGCGTCCGCGAGCGCTGATGTCGAGATCGCCGCGAAGAAGACCGTGCATCTCGCGG
TGAGCGGCGGCGCGCACGTGACGATCGAAGGCGGCGACGTCACGTTCGGTTGCCCGGGCAAATTCGTCGT
GTATGCCGCACAGCACGCGTTCGTGGGCCCCGATCAGATGAATCCGCCGTTGCCGCAGTTTCCCGAGAAG
GTCTGCGTCGAATGCCTGCTGCACGCGATGCAGTCGGGCAGCGCGCTGGCGGGCAAGGCGATCTGA