SecReT6
Effector Protein ID: 402781084
-
SecReT6 ID691
T6SS typeA2
Gene symbol-
Locus tagA79E_2835
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2997031..2997522 [-]
Productcytoplasmic protein USSDB7A
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDK4H4F0
KEGG IDkpp:A79E_2835
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|402781084|ref|YP_006636630.1| cytoplasmic protein USSDB7A [Klebsiella pneumoniae subsp. pneumoniae 1084]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2997522-2997031 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCCCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATTCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCC
TACCTGTACAAGGCGGTGACCACCGGCCAGACCCTGAAATCCGCCGAGTTCAAGTGGTACCGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATACCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCCGCCTACGAGAAGCACAACCATCTGGAACAGATTGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA