SecReT6
Effector Protein ID: 402783617
-
SecReT6 ID641
T6SS typeA1
Gene symbol-
Locus tagHCN_1362
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1367652..1368167 [+]
Productsecreted protein Hcp
Effector typeProtein
Homologous effectorHH0243
DescriptionHcp protein
UniProt IDI2FJ73
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-37, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|402783617|ref|YP_006638948.1| secreted protein Hcp [Helicobacter cinaedi PAGU611]
MAQPAYIKIEGSTQGLISSGASTEASIGNRYQAGHEDEIMAQEVAHIVTVPTDPQSGQPSGQRVHKPFSF
TCSLNKAVPLLYNALTSGERLTSVEIHWFRTSTSGGQEHYFTTKLEDAIITDINLVMPNAQEQNNSDKTE
LFKVSLNYRKVIWEHIAAGTSGSDDWRETKV
-
Nucleotide Sequence: 516 bp     [Download]
>gi|386760820|ref|NC_017761.1|:1367652-1368167 Helicobacter cinaedi PAGU611, complete genome
ATGGCACAACCAGCCTATATAAAAATTGAGGGTTCTACTCAAGGACTTATTTCAAGTGGAGCTTCCACAG
AAGCGAGTATTGGAAATCGTTACCAAGCAGGACACGAAGACGAGATTATGGCACAAGAAGTTGCTCATAT
TGTAACCGTTCCAACAGACCCACAAAGCGGACAACCATCAGGGCAAAGAGTGCATAAGCCTTTTTCTTTT
ACCTGTTCTTTAAATAAAGCTGTTCCTCTGCTTTATAATGCACTCACAAGCGGGGAGAGATTAACAAGTG
TAGAAATTCATTGGTTTAGAACTTCTACAAGTGGGGGACAAGAGCATTATTTCACAACAAAATTAGAAGA
CGCTATTATTACAGATATTAATCTTGTAATGCCTAATGCACAAGAACAAAACAATAGCGATAAAACAGAG
CTTTTTAAAGTTTCTCTCAATTATAGAAAAGTGATTTGGGAGCACATTGCCGCAGGGACAAGTGGAAGTG
ATGATTGGAGAGAAACTAAAGTTTAA