SecReT6
Effector Protein ID: 403056909
-
SecReT6 ID692
T6SS typeA1
Gene symbol-
Locus tagPCC21_004700
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]523320..523799 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA0456
DescriptionHcp protein
UniProt IDJ7KKL1
KEGG IDpcc:PCC21_004700
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-29, Aligned region: 6..144
Protein Sequence: 159 a.a.     [Download]
>gi|403056909|ref|YP_006645126.1| hypothetical protein PCC21_004700 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYATNYDLSRDRHVNHHPFSVTKVVDKSTP
LVLTSIANNELLEIELRYYRTSASGTQENYMTITLRDASIVNISNQNPNSLTHNDMQPFETLSLRYESIT
CQHNIAGTSGYSILTENMY
-
Nucleotide Sequence: 480 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c523799-523320 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGGCTAATTCTATTTTCATGAAGATCACCGGAAAAATTCAGGGACTGATATCTGAAGGGTGTTTAAGTA
TCGATTCTGTAGGAAATAAACATATCTCTGGTCACGAAGATGAAATTTTTGTTTATGCCACAAATTACGA
CCTATCAAGAGATCGACACGTCAATCATCATCCCTTTTCTGTGACCAAAGTCGTTGATAAGTCTACACCG
TTAGTCCTAACTAGCATCGCTAATAATGAACTGCTGGAAATTGAGTTGAGATATTACCGCACCTCCGCCA
GCGGGACGCAAGAGAACTACATGACAATCACATTAAGGGATGCCTCTATTGTCAATATCTCTAATCAGAA
CCCCAACTCATTGACACATAACGATATGCAGCCATTTGAAACCCTGAGCCTGCGTTATGAAAGCATTACC
TGCCAACACAATATTGCAGGGACATCGGGATACAGCATATTAACTGAAAATATGTACTGA