SecReT6
Effector Protein ID: 403059664
-
SecReT6 ID692
T6SS typeA1
Gene symbol-
Locus tagPCC21_032250
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3645985..3648021 [-]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDJ7KTF8
KEGG IDpcc:PCC21_032250
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-70, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 2.70E-70, Aligned region: 489..558
Phage_base_V [PF04717], Evalue: 9.40E-23, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|403059664|ref|YP_006647881.1| ImpA family type VI secretion-associated protein [Pectobacterium carotovorum subsp. carotovorum PCC21]
MANSTGLQFTVKVGALEAGTFAVVDFRLDEGLNRPFSLSLSLASALPDVDFGVVLDQPCELMIWYEGELK
RRVSGIISGFTQGDTGFRRTRYQIEVRPALWRLGLRTNARIFQAQKPEAIIGALLEEAGITDYAFALRNE
HAVREYCVQYRESDLAFITRLAAEEGIYFFHEYEEGKHRVVFADDAGALTKGPELFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSGELAHQRESYQHYDYPGRYKQDPSGKAFSGYRLDAL
RSGAVTSEGESNCAGLMPGNTFTLTEHPNATLNAVWQTVSVTHVGQQPQALEEESGGEPTTMSNSFAVVK
GTTTWRAAMPYKPMVDGPQIATVVGPTGEEIYCDPYGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPTPYVLPAHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYYHAQKDMDGVINNIHRQSVGRDQHLSVDQDQFQRVTRHRHRTIGKDDFENIGQDHHQEIGRSFIQ
KIGASFKRFIGGGEITRIEGSRQTTMSGSEETLIGAHQRVLVNTDSYLKAADIVLEAGQALTIKGPGGFI
KIDSAGVTISGTIVKINDGGAAGVGTAPVSITPEDPTKPTLPDAPDRR
-
Nucleotide Sequence: 2037 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3648021-3645985 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
GTGGCAAACAGTACAGGATTACAGTTCACCGTAAAGGTCGGTGCCCTGGAAGCAGGCACTTTCGCGGTGG
TGGATTTCAGGCTGGATGAAGGGCTGAACCGGCCTTTCAGCCTGTCGCTGAGTCTGGCGAGTGCGTTGCC
GGATGTCGATTTCGGCGTGGTGCTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAAGGCGAACTGAAA
CGTCGGGTCAGCGGAATTATCAGCGGCTTTACGCAGGGTGACACCGGATTCCGGCGCACGCGCTATCAGA
TAGAGGTCCGTCCTGCCCTGTGGCGACTGGGATTACGCACCAACGCCCGCATCTTTCAGGCGCAAAAGCC
GGAAGCGATTATCGGGGCGCTGCTGGAAGAAGCCGGTATCACCGACTACGCCTTTGCGCTGCGTAACGAG
CATGCGGTACGGGAATACTGCGTGCAGTATCGGGAAAGCGATTTAGCCTTTATCACCCGGCTGGCCGCCG
AGGAGGGCATATATTTCTTCCACGAATACGAAGAGGGTAAACACCGGGTGGTGTTTGCTGACGATGCGGG
CGCACTGACCAAAGGCCCCGAGCTGTTCTTCAATCTGGCGACGCAGGGGCTGAGTGAGGGCGAATATGTC
CGGCGCTTCCACTACGCGGAGCGGGTGAGTACGGCCGAAGTCGAGCTGAAAGACTACAGCTTCAAGACAC
CGGCTTACGGGCTGTCGCACAAGAAAATGAGTGGCGAGCTGGCGCACCAGCGCGAAAGCTACCAGCATTA
CGACTACCCGGGGCGCTATAAGCAAGACCCGAGTGGTAAGGCGTTCAGCGGCTACCGGCTGGATGCGCTG
CGCTCAGGGGCGGTGACGAGCGAAGGGGAATCCAACTGTGCGGGGCTGATGCCGGGTAACACCTTCACGC
TGACGGAGCACCCGAATGCGACGCTGAATGCGGTGTGGCAGACGGTGAGCGTGACGCACGTCGGGCAACA
GCCGCAGGCGCTGGAAGAGGAAAGCGGCGGCGAACCGACGACCATGAGCAACAGTTTTGCGGTGGTGAAA
GGGACAACGACGTGGCGTGCTGCCATGCCTTACAAACCGATGGTGGACGGGCCACAAATCGCCACCGTCG
TCGGCCCAACGGGAGAAGAAATCTACTGCGACCCGTATGGTCGGGTAAAACTACAATTCCCGTGGGATCG
CTACGGTGCGAGTAATGACCAGAGTTCCTGCTGGGTGCGCGTCAGTCAGGGCTGGGCGGGTGGCCAGTAC
GGCATGATTGCCATCCCGCGTATCGGTCATGAAGTGATCGTCAGCTTCCTTGAAGGCGATCCGGACCAGC
CGATTGTCACCGGGCGTACTTTCCACGCCACCAACCCGACGCCGTACGTTTTACCGGCACATAAAACGCG
TACCACGCTTCGTACCGATACGCATAAAGGTAGTGGCTTCAACGAACTGCGTTTTGAGGATGAGGCGACG
CGTGAACAGATTTACTATCACGCTCAGAAAGATATGGATGGTGTTATCAACAACATCCACCGGCAGAGCG
TAGGGCGCGATCAGCACCTCAGCGTGGATCAGGATCAGTTCCAACGGGTCACGCGTCACCGCCACCGAAC
GATAGGCAAGGATGATTTTGAAAACATCGGTCAGGATCATCACCAGGAAATTGGCCGGAGTTTTATTCAG
AAAATTGGTGCGTCGTTCAAACGTTTCATCGGTGGGGGGGAGATTACCCGTATCGAAGGGAGCCGTCAGA
CCACGATGTCTGGTTCTGAAGAGACGCTGATCGGCGCGCACCAGCGCGTTCTGGTGAATACGGACAGCTA
CCTGAAAGCTGCGGATATCGTGCTGGAAGCGGGGCAGGCACTGACCATCAAAGGGCCTGGCGGCTTTATC
AAGATTGATAGCGCGGGTGTCACAATTTCCGGGACGATTGTGAAAATCAACGATGGCGGTGCGGCTGGCG
TAGGGACTGCGCCAGTATCCATTACGCCAGAAGATCCGACGAAGCCTACGCTGCCCGATGCGCCAGACAG
ACGTTAA