SecReT6
Effector Protein ID: 403059741
-
SecReT6 ID692
T6SS typeA1
Gene symbol-
Locus tagPCC21_033020
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3748321..3750348 [-]
ProductvgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDJ7KZU4
KEGG IDpcc:PCC21_033020
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-70, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 7.40E-23, Aligned region: 367..459
Phage_base_V [PF04717], Evalue: 7.40E-23, Aligned region: 563..576
DUF2345 [PF10106], Evalue: 4.80E-05, Aligned region: 564..612
Protein Sequence: 675 a.a.     [Download]
>gi|403059741|ref|YP_006647958.1| vgrG protein [Pectobacterium carotovorum subsp. carotovorum PCC21]
MANSTGLQFTVKVGALEAGTFAVVDFRLDEGLNRPFSLSLSLASALPDVDFGAVLDQPCELMIWYEGELK
RRVSGIISGFTQGDTGFRRTRYQIEVRPALWRLGLRTNARIFQAQKPEAIIGALLEEAGITDYAFALRNE
HAVREYCVQYRESDLAFITRLAAEEGMYFFHEYEEGKHRVVFADDAGALTKGPELFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSGELSHQRESYQHYDYPGRYKQDPSGKAFSGYRLDAL
RSGAVTSEGESNCAGLMPGNTFTLTEHPNATLNAVWQTVSVTHVGQQPQALEEESGGEPTTMSNSFAVVK
GTTTWRAAMPYKPMVDGPQIATVVGPTGEEIYCDQYGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTVLRTKTHQGEGFNELRFEDQAG
QEEIYIHGQKDLKALVENDVVWHIKHDAHTEIDNERVTRVKANDHLTVENEKRDHVKGALSLTVDASMHQ
KLGQALLVEAGEEVHVKAGAKVVLEAGAELTLKVGGSFVKIDPSGVTLVGPGIKMNSGGSPGCGSGWAGQ
LPSLPGTVEVMAPPQLPKIPPLEKPVCIPCLLRAMAQGDALIQGE
-
Nucleotide Sequence: 2028 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3750348-3748321 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGGCAAACAGTACAGGATTACAGTTCACCGTAAAGGTCGGTGCCCTGGAAGCAGGCACTTTCGCGGTGG
TGGATTTCAGGCTGGATGAAGGGCTGAACCGGCCTTTTAGCCTGTCGCTGAGTCTGGCGAGCGCGTTGCC
GGATGTCGATTTCGGCGCGGTGCTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAAGGCGAACTGAAA
CGTCGGGTCAGCGGGATTATCAGCGGCTTTACGCAGGGTGACACCGGTTTTCGGCGCACGCGCTATCAGA
TAGAGGTCCGTCCTGCCCTGTGGCGACTGGGATTACGCACCAACGCCCGCATCTTTCAGGCGCAGAAGCC
GGAGGCGATTATCGGGGCGCTACTGGAAGAAGCGGGCATCACCGACTACGCCTTTGCGCTGCGTAACGAG
CATGCGGTGCGGGAATACTGCGTGCAGTATCGGGAAAGCGATTTAGCCTTTATCACCCGGCTGGCTGCCG
AGGAGGGCATGTATTTCTTCCACGAATACGAAGAGGGTAAACACCGGGTGGTGTTTGCCGACGATGCGGG
CGCACTGACCAAAGGCCCCGAGCTGTTCTTCAATCTGGCGACGCAGGGGCTGAGTGAGGGCGAATATGTC
CGGCGCTTCCACTACGCGGAGCGGGTGAGTACGGCCGAAGTCGAGCTGAAAGACTACAGCTTCAAGACAC
CGGCTTACGGGCTGTCGCACAAGAAAATGAGTGGCGAGTTGTCGCACCAGCGCGAAAGCTATCAGCATTA
CGACTACCCGGGACGCTATAAGCAAGACCCGAGCGGCAAGGCGTTCAGCGGCTACCGACTGGATGCGCTG
CGCTCAGGGGCGGTGACGAGCGAAGGGGAATCCAACTGCGCGGGGCTGATGCCGGGCAACACCTTCACGC
TGACGGAGCACCCGAATGCGACGCTGAATGCGGTGTGGCAGACGGTGAGCGTGACGCACGTCGGGCAGCA
GCCGCAGGCGCTGGAAGAAGAAAGCGGCGGCGAACCGACCACCATGAGCAACAGTTTTGCCGTGGTGAAA
GGCACAACGACGTGGCGTGCTGCCATGCCCTACAAACCGATGGTGGACGGCCCACAAATCGCCACCGTCG
TCGGCCCAACGGGGGAAGAAATCTACTGCGACCAGTATGGTCGGGTAAAACTGCAATTTCCGTGGGATCG
CTACGGTGCGAGCAATGACCAGAGTTCCTGCTGGGTGCGGGTCAGTCAGGGCTGGGCGGGCGGCCAGTAC
GGCATGATTGCCATCCCGCGTATTGGCCATGAAGTGATCGTCAGCTTCCTTGAAGGCGATCCGGACCAGC
CGATTGTCACCGGGCGTACTTTCCACGCCACCAATCCCTCGCCGTATCCGCTGCCTGCCAATAAGACACG
AACCGTACTGCGCACGAAGACGCATCAGGGAGAAGGATTTAATGAATTGCGCTTCGAGGATCAGGCCGGT
CAGGAGGAGATTTATATTCACGGGCAGAAAGACCTCAAGGCGCTCGTTGAGAACGATGTGGTCTGGCACA
TCAAACATGATGCCCACACGGAGATTGATAATGAGCGAGTCACCCGCGTTAAAGCCAACGATCACCTGAC
GGTTGAGAACGAGAAACGTGACCACGTGAAAGGAGCTCTTTCGCTGACCGTTGATGCGTCGATGCATCAG
AAACTGGGGCAGGCTTTGCTGGTCGAGGCGGGTGAGGAAGTGCATGTAAAAGCGGGGGCTAAGGTGGTTC
TTGAAGCGGGCGCGGAGCTGACGCTGAAAGTCGGAGGAAGCTTCGTGAAGATCGATCCCAGCGGCGTGAC
GCTGGTCGGCCCCGGCATCAAGATGAATTCAGGTGGCAGCCCGGGTTGTGGCTCTGGTTGGGCAGGTCAA
CTGCCCTCATTACCGGGAACCGTTGAGGTGATGGCGCCGCCCCAACTGCCCAAAATACCGCCTCTTGAAA
AACCGGTCTGTATTCCCTGTCTGCTGCGTGCCATGGCGCAGGGCGATGCATTGATACAGGGAGAATAA