SecReT6
Effector Protein ID: 403060578
-
SecReT6 ID692
T6SS typeA1
Gene symbol-
Locus tagPCC21_041390
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]4701775..4702293 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDJ7L534
KEGG IDpcc:PCC21_041390
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|403060578|ref|YP_006648795.1| type VI secretion system effector [Pectobacterium carotovorum subsp. carotovorum PCC21]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDATIVDVNCQMPHCQDPAKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|403056439|ref|NC_018525.1|:4701775-4702293 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACGCAGGGCAACATCACCGCGGGTGCTTTCACTT
CTGATTCTGTCGGCAACATCTATGTGGAAGGCCACGAAGACGAAATGCTGGTTCAGGAATTCAAACACAT
CGTCACCGTACCGACCGACCCACAGTCTGGTCAGCCGTCCGGCCAACGTGTACACAAACCGTTCAAATTC
ACCGTCGCGCTGAACAAAGCGGTTCCACTGATGTACAACGCCCTGGCTTCCGGCGAAATGCTGCCGACCG
TGACCCTGAAATGGTACCGCACGTCGGTTGAAGGTAAGCAAGAGCACTTTTTCTCTACCGTGCTGACCGA
TGCCACCATCGTTGACGTTAACTGCCAGATGCCACACTGCCAGGATCCGGCGAAGCTGGACTACACCCAG
CTGATCGAAGTATCGCTGGCCTACCGCAAAATCGATTGGGAACACACCGTTGCAGGAACCTCTGGTTCCG
ATGACTGGCGTGCGCCGGTCGAAGCGTAA