SecReT6
Effector Protein ID: 403060579
-
SecReT6 ID692
T6SS typeA1
Gene symbol-
Locus tagPCC21_041400
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]4702384..4704243 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDJ7KW11
KEGG IDpcc:PCC21_041400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-67, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.50E-22, Aligned region: 367..459
Phage_Mu_Gp45 [PF06890], Evalue: 0.0058, Aligned region: 419..446
Phage_Mu_Gp45 [PF06890], Evalue: 0.0058, Aligned region: 541..581
Protein Sequence: 619 a.a.     [Download]
>gi|403060579|ref|YP_006648796.1| hypothetical protein PCC21_041400 [Pectobacterium carotovorum subsp. carotovorum PCC21]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLASPLPGIDFGAVLDQPCELLVWYEGELQ
RRVSGIVSAFAQGDTGFRHTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGALLEESGITDYAFALRNE
HAVREYCVQYRESDLAFITRLAAEEGLYFFHEFEEGKHRLVFADDAGALAKGPELFFNLATQGLSEGAYV
RRFRYAEAVRTAEVALKDYSFKTPAYGLLHNKMSGELEHQRESYQHFDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGSGESNAAELMPGSSFTLTEHPNLALNIAWQLVAITHSGQQPQALEEESSGEPTTYSNSFEVVK
ASTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTTLRTTTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTGVGVDHAENVGRDQISVIGRHQILNVVENQGTEIQGAQKVIIGAGRET
EITMNEKLTVTGNITITSTGGNIELTTGAGSLTIYQNGNIDIKGVKVNVVGSERIDLNK
-
Nucleotide Sequence: 1860 bp     [Download]
>gi|403056439|ref|NC_018525.1|:4702384-4704243 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGGCAAACAGTACAGGATTACAGTTCACCGTTAAGGTCGGCGCATTACCTGCATCGACCTTTGCCGTGG
TGGATTTTCAGCTCAGCGAGGCGCTTAACCAGCCGTTTGCCCTGTCGCTGAATCTGGCCAGCCCCTTACC
GGGGATCGATTTTGGTGCTGTTCTCGACCAGCCCTGTGAACTCCTGGTGTGGTACGAAGGCGAACTCCAA
AGACGCGTGAGCGGCATTGTCAGCGCGTTCGCGCAGGGCGACACCGGCTTTCGCCACACGCGCTATCAGG
CGGAAGTCCGTCCGGCGCTGTGGCGTTTAGGGCTACGCACTAACGCCCGTATTTTTCAGGCACAGAAACC
GGAAGCCATTATTGGCGCGCTGCTCGAAGAATCCGGCATCACCGACTACGCCTTTGCGCTGCGTAACGAG
CACGCGGTGCGGGAATACTGCGTGCAGTATCGGGAAAGCGATTTAGCCTTTATTACCCGGCTGGCCGCAG
AGGAAGGTCTGTACTTCTTCCATGAATTTGAAGAAGGCAAACATCGGCTGGTTTTTGCCGACGATGCCGG
CGCGCTGGCCAAAGGCCCTGAGCTGTTTTTCAACCTTGCCACACAGGGGCTGAGCGAAGGGGCATATGTA
CGCCGTTTCCGCTATGCCGAGGCGGTGCGAACTGCCGAGGTGGCGCTGAAGGATTACAGCTTCAAAACCC
CCGCCTACGGATTGCTGCACAACAAGATGAGTGGTGAGTTGGAGCACCAGCGCGAAAGCTATCAACACTT
CGACTACCCCGGTCGTTTTAAACAAGATCCGAGCGGCAAAGCCTTTACTGGCTATCGGCTGGACGCGCTG
CGAGCAGGGGCGATGACCGGCTCGGGCGAATCCAATGCCGCCGAACTGATGCCGGGCAGCAGTTTTACCT
TAACTGAACACCCCAATCTGGCACTCAATATCGCCTGGCAACTGGTTGCCATTACCCACAGCGGGCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCAGCGGCGAACCGACCACCTACAGCAACAGCTTCGAGGTCGTGAAA
GCCAGCACCACCTGGCGCGCCGATCTGCCGTACAAACCGATGGTAGACGGCCCACAAATCGCCACCGTTG
TCGGCCCGGCGGGTGAAGAGATTTACTGCGACCAGTACGGCCGGGTGAAACTGCAATTCCCATGGGACCG
CTACGGCGCGAGCGATGACCAGAGCTCCTGCTGGGTTCGCGTCAGCCAGGGCTGGGCCGGTGGTCAGTAC
GGCCTGATCGCTATTCCGCGCATCGGCCATGAAGTCATTGTGAGTTTCCTCGAAGGCGACCCGGATCAGC
CCATCGTGACGGGCAGAACCTTCCATGCCACTAATCCATCGCCCTACCCGCTGCCCGCCAACAAAACACG
CACCACGCTGCGCACCACAACCCACAAAGGCGCTGGGTTCAACGAGCTGCGCTTTGAGGATCAGGCTGGT
CAGGAAGAAGTGTTTATCCATGCTCAGAAAGACATGAACACCGTAGTACTGAATAACCGCAGTACGGGTG
TAGGCGTCGACCATGCAGAGAACGTCGGACGAGATCAGATCAGTGTCATAGGCCGCCATCAAATTCTTAA
CGTCGTCGAGAATCAGGGAACGGAGATTCAGGGTGCCCAGAAAGTCATCATCGGGGCAGGCCGAGAAACC
GAGATCACGATGAACGAGAAGCTGACGGTAACGGGAAATATCACCATCACCTCGACCGGCGGCAATATCG
AACTGACGACGGGAGCAGGATCGCTGACCATTTATCAGAATGGCAATATCGACATCAAGGGCGTGAAGGT
CAACGTGGTTGGCAGTGAACGTATTGATTTAAATAAATAA