SecReT6
Effector Protein ID: 403516745
-
SecReT6 ID693
T6SS typeA4b
Gene symbol-
Locus tagBPC006_I0077
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]75552..76520 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDK7Q2A9
KEGG IDbpq:BPC006_I0077
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 322 a.a.     [Download]
>gi|403516745|ref|YP_006650878.1| hypothetical protein BPC006_I0077 [Burkholderia pseudomallei BPC006]
MRMCGRPAYVAPPGVIDWRGRAMPRVCERAGAQRVNERARGGIPCAIFRVRSCMRDSGEQERAAHAMSDR
RAGQGAAAQTACASRAFGVFRVRVRDRLVSAYIERGCRCRRASRRPCAARMHTPARPMRARRANCTRRGI
CVELSRRLIVSRICPTIRFAWLVAAIRIPLIKTEGTMPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAP
TGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAPVKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTK
DGGILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGDNFYVVE
-
Nucleotide Sequence: 969 bp     [Download]
>gi|403516668|ref|NC_018527.1|:75552-76520 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGCGGATGTGCGGTCGGCCCGCCTACGTCGCGCCGCCCGGCGTGATCGATTGGCGCGGGCGCGCGATGC
CTCGCGTTTGCGAACGCGCCGGCGCTCAACGGGTAAACGAACGAGCGCGCGGCGGTATTCCGTGCGCGAT
ATTCCGCGTGCGCTCTTGCATGCGCGACAGCGGCGAGCAGGAACGCGCGGCGCACGCGATGAGCGACCGG
CGCGCCGGGCAAGGCGCGGCTGCGCAAACGGCATGCGCGTCGCGCGCCTTCGGTGTTTTTCGTGTTCGTG
TCCGCGATCGGCTTGTGTCCGCGTACATTGAGCGCGGATGCCGTTGCCGTCGCGCATCGCGGCGGCCGTG
CGCGGCGCGCATGCATACGCCGGCACGGCCGATGCGCGCGCGACGCGCAAACTGCACGCGGCGCGGGATT
TGTGTTGAATTGTCGCGGCGGTTGATCGTTTCGCGCATCTGCCCGACAATCCGGTTCGCTTGGCTGGTTG
CGGCAATTCGAATTCCGCTTATAAAAACCGAGGGAACCATGCCTTACGTGTCGACCCATTACTCGAACAA
CGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGACTTCGAAGCTCGCGCCTTTCGACAAGGCGCCG
ACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCAATGCGTGTCCTACGTGAAACGGGTCTGCCCGA
CGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCGGTGAAAGGCAACGCGACGATCGTCGCGGGCAC
CGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACGGCCACGCGGCGATCTACGTCAGCCAGACGAAG
GACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCCGCCGACGCCGCAGCCGGTTCGGCAACGGCGCC
TGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGATAACTTCTATGTCGTGGAGTAA