SecReT6
Effector Protein ID: 403518308
-
SecReT6 ID693
T6SS typeA4b
Gene symbol-
Locus tagBPC006_I1654
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]1592179..1594227 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDK7PU29
KEGG IDbpq:BPC006_I1654
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 7.10E-36, Aligned region: 140..161
DUF2235 [PF09994], Evalue: 7.10E-36, Aligned region: 165..289
Protein Sequence: 682 a.a.     [Download]
>gi|403518308|ref|YP_006652441.1| hypothetical protein BPC006_I1654 [Burkholderia pseudomallei BPC006]
MLRIHDILHAYVHGQTLTAVLGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSFGDIKLRANSGVGALKLI
AAEQNGVELTWDLDTNWAQLKNELDSSKWNAAVQEWDAKRRKVLLDRRAQLKARIGDLLVKGKPKLQRIR
LYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKE
LMAVPHYVRRCVHMVAAHEPRGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQV
PLLDMYREARKAGVPLDINGPGIGADVIAAFKVSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLY
LRWRKMRLKDMHAQPSFKAAQARYPQDAADLDSANAELKEEWNDLLEVEKAGGPTITRYVEKFVTKWASE
NPKTAAVVSTSLLPAAVAAEVFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISA
LYDNYMHDSRAWFKPLGDDDDVWNHRQIQELKTKQASFERAHAAWKKRVEMGMPSLLQVTQAMGVGSTGW
GPVGGLPPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREF
YFLWGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2049 bp     [Download]
>gi|403516668|ref|NC_018527.1|:1592179-1594227 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
TTGCTTCGGATTCACGATATTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCAGTGTTAGGAAAGC
GCTACGAGGAACTCGTAAAATCGATGAGCCTCGATATGAATTTTAAGGGCATCGACCTTGGCGGAACGCC
GCCTAAACCGGGAAGCTTCGGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCTCAAGCTGATT
GCTGCCGAACAGAATGGTGTCGAGCTGACTTGGGATTTAGATACGAATTGGGCGCAGCTCAAAAACGAGT
TGGATTCGTCGAAGTGGAATGCAGCCGTGCAAGAATGGGACGCCAAGCGCCGTAAGGTATTGCTCGATCG
TCGTGCTCAGCTAAAAGCGCGCATCGGTGATCTGCTGGTCAAGGGGAAGCCGAAGCTGCAACGCATTCGG
CTATACGTATTCGGCTTTTCGCGCGGTGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTTGCTGACGCGC
TTGACCCCGATTTCAGTTTGTGTGGAGTGCCGGTTTCATACGATTTTCTCGGTATCTTTGATACGGTCGC
ATCGGTCGGCATCGCTCAGAGCGCCGCCGCAACATTATTCGACGGACATGGAGGATGGGGGCGCAAGGAA
CTGATGGCCGTGCCGCATTATGTGCGCCGTTGCGTGCACATGGTGGCGGCACATGAACCTCGTGGATCAT
TTCCGCTCGACCTTATCGATTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTGTTCACTCGGA
CGTCGGCGGCGGCTATGGGCCGGGCGAACAGGGGCGCGGTCGGGACGACGCCGACAAACTTTCGCAAGTC
CCGCTGCTTGATATGTACCGGGAGGCGCGTAAGGCAGGTGTGCCCTTGGATATCAATGGGCCAGGTATCG
GCGCGGACGTCATCGCTGCATTCAAGGTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCTACGTAAAAAA
GAGCGAGAACTATTATTACGAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTACGGCTTGTAT
CTCCGGTGGCGCAAGATGCGGCTCAAGGACATGCATGCACAGCCCAGCTTCAAGGCTGCGCAGGCGCGCT
ATCCGCAAGATGCAGCGGATCTGGACAGTGCGAACGCGGAATTGAAGGAGGAGTGGAACGATTTGCTGGA
GGTCGAGAAAGCTGGCGGCCCGACAATCACCCGATACGTGGAGAAGTTTGTTACGAAATGGGCCAGTGAG
AATCCGAAAACGGCCGCCGTCGTTTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAGGTTTTTGTTC
CGGGGGTTAGCGCTGCGACGGTTCTATTCGGCGACAAAGTGGTGAAACTGGTGCAAGCCCAACTCAAGGA
GAAGTGGGAGCAGTGGCTGCAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGCGATCAGCGCA
CTCTACGACAACTACATGCACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGACGACGTGTGGA
ACCATAGGCAGATTCAGGAACTCAAGACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTGCCTGGAAAAA
GCGTGTCGAAATGGGCATGCCAAGCTTGTTGCAGGTTACACAGGCAATGGGCGTAGGTTCCACAGGATGG
GGGCCCGTCGGCGGGCTTCCGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAAGCCGATCTGC
TCAAGCGCTACGACGCCGCGATGCAGTCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGAACGCGCCGAC
GGACAGCGCCGTGCTGACCGATCCGAAGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGGCCGCGAGTTC
TATTTCCTGTGGGGCTTCCTGCGCTGGCGGACCGTGTTCGTGAACGGCGTGCGCTGGGACCAGCCGCGCG
TGCCGACGGTGCAGGAGGAAATGGAGGGCATGCGCATGCAGATGCAACGCCAGGTCGACATGAAGGGCAT
CGGCGTACTGTTCCAATGA