SecReT6
Effector Protein ID: 403518310
-
SecReT6 ID693
T6SS typeA4b
Gene symbol-
Locus tagBPC006_I1656
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018527] [Browse all T6SS(s) in this replicon]
Location [Strand]1594336..1597671 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDK7PZX1
KEGG IDbpq:BPC006_I1656
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-51, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 6.20E-51, Aligned region: 668..770
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 588..636
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 667..820
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 516..623
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 693..720
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 384..497
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 576..589
Protein Sequence: 1111 a.a.     [Download]
>gi|403518310|ref|YP_006652443.1| Rhs element Vgr protein [Burkholderia pseudomallei BPC006]
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLA
TGAGERSWNGYVTHAAYADSDGEITRYRLTMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPQARRRY
ELKEPLRKFSLRGQYRETDDTFVLRQLAEAGLSFRIEHAQDAGKEASGDHTVVVFDRRAPFRHGSTIAYN
LQDVGDPDGVITQFSERHQMVPDRVVATSWKADELLALAGHAQQPPEDKAPVLPVREIYDGQRAGRFDTI
DDAQRFAEQRLDALRLPKRIHYGAGSSRTLEIGAVHTLAGYLDRAITFVPLSIEHEAVNNLGADIGALLG
RGELDKGLYRNRFVAVPDGTPIVPPHRDRPIVHGVQTAIVVGEAGSRVSSTRDHQVRVQFPWMRGTAPLP
GGLTDTASRSNPAGHAPGDHRSGVLARVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDMPVVLGQVYGG
RVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGAM
RGAYRGEGFELATDGWGVVRAGEGVLVSSTARRLATSTQMDVAQSVGQLKQAVRTAQGMSESAAAAHAGG
LAANAAQADFLKAIDPAQDGKYTGAVNGQSATKASGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAV
SYAAQHVHLTAQRDAHVAAAATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSTMEILADQSVRITS
TDDRIDVLAKDAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPIPAPLALFDE
QIRFVNEDGEPLGNVAYQLKLADGSTVSGVTDDNGRTERVSTDEPTAIQSATLTPTQVVDCCGRTSDVPP
PAVKVDIKGVGTHDTLVGSSEQSVTVKGESRPLTDGEIEMAKTVFQDSIDYSAVRVHKGSYFWFNLQSKR
TAVTPNNTMYFREEDFVEDFSVVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRGESAYRYEIEP
GQVFSDFNMEQQGNLVSDYFALVVVDNRGELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK
-
Nucleotide Sequence: 3336 bp     [Download]
>gi|403516668|ref|NC_018527.1|:1594336-1597671 Burkholderia pseudomallei BPC006 chromosome I, complete sequence
ATGGATTTAGTCGCCGCATTGACGGGCTATTCTCAAACGACTCGCCACATCCGGATCGACACGGCGATGC
CGGGCGCGTTCGTGGTCGAACGTTTCCATGGGCGCGAGGGCGTCAACGAATCGTTTCGCTTCGAGATCGA
CGTGCTGTCGAGCGAGCCGTTTCTCGATCTGACGCCGCTCATCGGCCACGCGGCGCGGCTGCGTCTCGCG
ACGGGCGCGGGCGAGCGCAGCTGGAACGGCTATGTGACGCATGCGGCGTATGCGGACAGCGACGGCGAGA
TCACCCGCTATCGCCTCACGATGGAGTCGTGGCTCGCGCTGTTGCGCCTGCGTCGCAATTGCCTGTACTT
CGTCGACGTCGACACGAAGGACATCTGCGAGCGTGTGTTCGGCGATTATCCGCAAGCGCGTCGGCGCTAC
GAACTGAAGGAACCGCTGCGCAAGTTCAGCCTGCGCGGCCAGTACCGGGAGACCGACGACACGTTCGTGC
TGCGCCAGCTCGCCGAAGCCGGCCTGTCGTTCAGGATCGAGCATGCGCAGGATGCGGGCAAGGAAGCGTC
GGGCGACCATACGGTCGTCGTGTTCGATCGGCGCGCGCCATTTCGGCACGGCAGCACGATCGCATACAAC
CTGCAGGACGTCGGCGATCCGGACGGCGTGATCACGCAGTTTTCCGAACGCCATCAGATGGTGCCGGACC
GGGTCGTCGCGACGAGCTGGAAAGCCGACGAATTGCTCGCGCTTGCCGGGCACGCGCAGCAGCCGCCCGA
GGACAAGGCGCCGGTGCTGCCCGTGCGCGAAATCTACGACGGCCAACGCGCGGGCCGCTTCGACACGATC
GACGACGCGCAGCGCTTCGCCGAGCAGCGGCTCGACGCGCTGCGCCTGCCGAAGCGGATCCATTACGGCG
CGGGCTCGTCGCGCACGCTCGAGATCGGCGCGGTCCATACGCTCGCCGGTTATCTGGACCGTGCGATCAC
GTTCGTGCCGCTGTCGATCGAGCACGAGGCGGTCAACAATCTCGGCGCCGACATCGGCGCGCTGCTCGGG
CGCGGCGAGCTCGACAAGGGGCTGTACCGCAACCGTTTCGTCGCGGTGCCCGACGGCACGCCGATCGTGC
CGCCGCATCGCGATCGGCCGATCGTGCACGGCGTGCAGACCGCGATCGTCGTCGGCGAGGCCGGCAGCCG
CGTCAGCAGCACGCGCGATCATCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCACGGCGCCGCTGCCC
GGCGGCCTGACCGACACGGCGAGCCGCTCGAATCCGGCCGGGCACGCGCCGGGCGATCATCGCTCGGGCG
TGCTCGCGCGCGTCGCGGAATCATCGGCCGGGCCGAACTTCGGGCATGCGTTCACGCCGCGCGTCGGCGC
CGAAGTGGTGATCGGCTTCGAGTCGGGCAACATCGACATGCCCGTCGTGCTCGGCCAGGTCTACGGCGGG
CGCGTGCAGCCGCCGTTCGCGGCGGGCGAAGGCAGCGACGCGAACCATCCGGGCACGCTGACCGGCCTGC
AGACGCAAACGCTCGATGGCCAGTCCGGCAGCCGCTGGGTAATGGACGACGCCGCGGGACAACTGCGGCA
CGAGCTGAGCAACTCGACCGCGAACAGCCGGCTCGCGCAGGGTTACCTGATCGATCAGCAGGGCGCGATG
CGCGGCGCGTATCGCGGCGAAGGCTTCGAGCTCGCGACCGACGGTTGGGGCGTCGTGCGCGCGGGCGAAG
GCGTGCTCGTATCGAGCACGGCGCGGCGGCTCGCGACGTCGACGCAGATGGACGTCGCGCAAAGCGTCGG
ACAACTGAAGCAGGCGGTGCGGACCGCGCAGGGCATGAGCGAATCCGCCGCCGCGGCGCACGCGGGCGGG
TTGGCCGCCAATGCCGCGCAGGCGGATTTCCTGAAGGCGATCGATCCGGCGCAGGACGGCAAGTACACGG
GCGCGGTCAACGGGCAGAGCGCGACGAAGGCGAGCGGCGCGCAGCGCGACGGCGGGGAGCCGGTCGAGCG
CTTCGCCGCGCCGGCCGTGCTGATGGAGTCGCCGGAGAACATCGTGCTGACGACGCCGCACAGCGCCGTC
TCGTATGCGGCGCAGCACGTGCATTTGACCGCGCAGCGCGACGCGCACGTAGCGGCCGCCGCGACGGTCG
CGGCCGCGTCGGGCGATGCCGTGAGCCTGTATGCCGCCGCGGGCGGCCTCCGGGCGATCGCGAGCGACGG
GCCGGTGAGCGTCGAGGCGCATACGTCGACGATGGAGATTCTCGCGGATCAGTCGGTGCGCATCACGTCG
ACCGACGATCGCATCGACGTGCTCGCGAAGGACGCGATCGTGCTGCAGCAGGGGCCGAACCGGATCACGC
TGAAGGGCGGCGACATCACGGTCGAGACGCCGGGGCAGTTCCTCGTGAAGTCGGGCGCGCATCCGTTTCC
GGGGCCGGCCGCGCAGAGCGTTTCACTGCCGCCGCTGCCGATTCCCGCGCCGCTCGCGCTGTTCGACGAA
CAGATTCGCTTCGTCAACGAAGACGGCGAGCCGCTCGGCAACGTCGCGTACCAGCTGAAGCTCGCCGATG
GCTCGACCGTGTCGGGCGTGACCGACGACAACGGCAGAACCGAGCGCGTATCGACGGACGAGCCGACGGC
GATCCAGTCGGCGACGCTCACGCCGACGCAGGTCGTCGACTGCTGCGGGCGAACTTCGGATGTGCCGCCG
CCGGCGGTGAAGGTCGACATCAAGGGCGTCGGCACCCACGACACGCTGGTGGGCAGCTCGGAGCAATCGG
TCACGGTCAAGGGCGAGAGCCGGCCGCTGACCGACGGCGAGATCGAGATGGCGAAAACCGTGTTTCAGGA
CAGCATCGATTACAGCGCGGTGCGCGTGCACAAGGGCAGCTATTTCTGGTTCAACTTGCAGAGCAAGCGT
ACGGCCGTGACGCCGAACAATACGATGTATTTCCGCGAAGAGGATTTCGTGGAGGATTTTTCGGTTGTCA
GCGAGGAGTATCCGAGGCGGGGTTGGTTCATGCACGAAATGACGCACGTTTGGCAACATCAACGAGGATA
TGCCGTGCGCTGGCATGCGCTTACCGTGACGATTCGCGGCGAGAGCGCGTATCGGTACGAAATCGAGCCC
GGGCAAGTCTTCAGCGATTTCAATATGGAGCAGCAAGGCAATCTTGTATCAGACTACTTTGCGCTCGTTG
TCGTGGACAATCGAGGTGAATTGATTCATGCGCAACCAGGAAGCAAGAATCAACTTCGCCAAGTGCTGGC
CCCACTTCTACAGGATCCCAAGGATGCATCGAATCTTCCGAAATAG