SecReT6
Effector Protein ID: 403522893
-
SecReT6 ID693
T6SS typeA4b
Gene symbol-
Locus tagBPC006_II1612
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]1635452..1637692 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3226
Description
UniProt IDK7QBS6
KEGG IDbpq:BPC006_II1612
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.60E-120, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00016, Aligned region: 38..61
Abhydrolase_6 [PF12697], Evalue: 0.00016, Aligned region: 227..311
PGAP1 [PF07819], Evalue: 0.0068, Aligned region: 38..43
PGAP1 [PF07819], Evalue: 0.0068, Aligned region: 249..302
Thioesterase [PF00975], Evalue: 0.0088, Aligned region: 147..188
Thioesterase [PF00975], Evalue: 0.0088, Aligned region: 258..359
Protein Sequence: 746 a.a.     [Download]
>gi|403522893|ref|YP_006658462.1| hypothetical protein BPC006_II1612 [Burkholderia pseudomallei BPC006]
MNGINDQCFTAARGAGVTMANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGAYGGEYAEAIKAKDQKSPFFDSRIANDPDMYLYRRAETGGTHSMFLPFYWGYRASDDEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPERRYFVLAAARLASLIRTIRAVRPSALALEHGMDPRHETITVMGHSQGTIITLLAQAMLKQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVQKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRRLLLLMADWKMTPDAMDKIAKCNAYG
RLETHTREFIDACAKYYQNGSFPAEKFVPLTLPPLVTSELKVDKRA
-
Nucleotide Sequence: 2241 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c1637692-1635452 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAACGGAATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGGCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGCTTGTCGCGAAGCGAT
CTGCGGCCGGGGGCGTATGGCGGGGAATATGCCGAAGCCATCAAAGCGAAAGACCAAAAGAGCCCGTTCT
TCGATAGCAGAATCGCCAACGATCCGGACATGTATCTGTATCGACGTGCGGAGACCGGCGGCACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAAGATCAGCCATCCAGGC
GAGGTCAAGAGCCGCGTCGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTGGAGCGCACGGTCATGCAAAACGCGCTGGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGAGCGCCGTTACTTCGTGCTTGCCGCGGCTCGCCTGGCGAGCCTCA
TCCGGACCATTCGGGCCGTCCGGCCTTCCGCGCTCGCGCTGGAGCACGGCATGGATCCTCGACACGAAAC
GATCACCGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGCGATGCTCAAGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCAGAAGGGCGGACAGGTGCCCGGGCACGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCATTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCGGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGC
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTGCTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGACGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCGGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGCCGGATGCAATGGATAAGATCGCGAAATGCAACGCTTATGGC
CGGCTTGAGACGCATACGAGGGAATTTATCGATGCGTGCGCGAAGTACTATCAAAATGGCTCGTTCCCTG
CGGAGAAGTTTGTGCCGCTTACTTTGCCACCACTCGTCACCAGCGAACTGAAAGTTGACAAGAGAGCATG
A