SecReT6
Effector Protein ID: 403524001
-
SecReT6 ID693
T6SS typeA4b
Gene symbol-
Locus tagBPC006_II2723
StrainBurkholderia pseudomallei BPC006
Repliconchromosome I [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2746518..2747423 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDK7QA74
KEGG IDbpq:BPC006_II2723
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 87..134
B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 190..229
Protein Sequence: 301 a.a.     [Download]
>gi|403524001|ref|YP_006659570.1| hypothetical protein BPC006_II2723 [Burkholderia pseudomallei BPC006]
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRFPTQAWGASAM
SQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGGY
PTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNL
PINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2746518-2747423 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAAAAAATACGCATTGGCGCTCTGGTTCATGCTGGTTTCATCGATGTCGGCAATGGCGGGGGCGATCA
TTCCATCGGGCGCAACGCTGGTTGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCATTCGGCGT
CGACGCCGCCAGCGGCAAGCTCTATTTCCACTACAGGTTCCCGACGCAGGCGTGGGGCGCGAGCGCGATG
TCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGCAGA
CCGACGGGCGACTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGCGCC
GATCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCTATC
CGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGCCAATGGCTGCAGATCTTCAACAACGTCACTTACTA
CCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTGTCG
GCTTCGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCAGTC
GAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGCCGCCCTCGCTGAACCTG
CCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA