SecReT6
Effector Protein ID: 407480451
-
SecReT6 ID701
T6SS typeA4b
Gene symbol-
Locus tagO3K_04365
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]889765..890259 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4564
DescriptionAaiC protein
UniProt IDK0AHY7
KEGG IDesl:O3K_04365
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 164 a.a.     [Download]
>gi|407480451|ref|YP_006777600.1| hypothetical protein O3K_04365 [Escherichia coli O104:H4 str. 2011C-3493]
MSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHIQDLL
ENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSIEMNI
PSDDGKSTEKLGPMTYNLYKEALV
-
Nucleotide Sequence: 495 bp     [Download]
>gi|407479587|ref|NC_018658.1|:889765-890259 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGAGTAATTCTTCCGCTCTTAGCAGGGAGTTTGTCAAAATAGAGATAGGTGGAAAAGTTATAAAGGGAA
ATTCAAAAGTTGAAAACAGTGGTGACTACTTTGATGGACATTGTCCTCAGGCATTTCACGCTTTTTCAGG
AATTGACGGTACTGTTTTTGATTTAATTAATTTGAAGCTTAGGGTTACTAAACACATACAAGACCTTCTG
GAGAACTTTTTTAAGAGAGGTGAAAAAGAAGTTAAAATAGAAATTTTACGTAGGGAATCAACTAAATCAG
GTAGTGCATACTCATCATTTAAGGTTGTTTATCAGGGGTGTCGTATGCATAATATGTTGTTGGCTCATGA
TAATGATTCAAATCTCATTCTGGAATTGTCGTTTACCCCAGAAGAGAGTGTCTCAATTGAGATGAATATT
CCGTCAGATGATGGAAAAAGTACGGAGAAATTGGGACCAATGACGTACAACTTATATAAAGAGGCTCTTG
TATAA