SecReT6
Effector Protein ID: 407712929
-
SecReT6 ID707
T6SS typeA2
Gene symbol-
Locus tagBUPH_01736
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1355929..1356414 [-]
Producttype VI secretion system secreted protein Hcp
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDK0DKP4
KEGG IDbpx:BUPH_01736
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-37, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|407712929|ref|YP_006833494.1| type VI secretion system secreted protein Hcp [Burkholderia phenoliruptrix BR3459a]
MAIPAYMWLKDDGGADIKGSVTVQGREGSVELVAFDHGVHIPTDGNTGKLTGTRVHKPIKLTKETDASTP
YLYKAVTSGQTLKSVEIKWYRIDDAGKEKEYFNTKLDNVKIVAVKPVMYDIKKPEYEKHNHLENVELRYE
TITWSYKDGNIIHKDTWNERS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|407711772|ref|NC_018695.1|:c1356414-1355929 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGGCAATTCCGGCCTATATGTGGCTCAAGGACGACGGCGGCGCGGACATCAAGGGGTCGGTGACAGTTC
AAGGGCGTGAGGGCAGCGTCGAACTCGTCGCATTCGACCACGGCGTGCACATCCCGACCGACGGCAACAC
GGGCAAGCTCACCGGCACCCGCGTGCACAAGCCGATCAAGCTGACCAAGGAAACGGACGCGTCGACCCCG
TATCTGTACAAGGCTGTGACGAGCGGTCAGACGCTCAAGTCTGTCGAAATCAAGTGGTACAGGATCGACG
ACGCGGGCAAGGAAAAAGAGTACTTCAACACGAAGCTCGACAACGTCAAGATCGTGGCCGTCAAGCCGGT
CATGTACGACATCAAGAAGCCGGAGTACGAGAAACACAACCATCTCGAGAACGTCGAACTGCGCTACGAG
ACCATCACCTGGTCCTACAAGGACGGCAACATCATCCACAAGGACACCTGGAACGAGCGTTCCTGA