SecReT6
Effector Protein ID: 409249543
hcp7
SecReT6 ID768
T6SS typeA1
Gene symbolhcp7
Locus tagSENTW_1074
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]71471..71989 [+]
ProductMajor exported protein Secreted protein hcp
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDE9A099
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0041, Aligned region: 93..136
Protein Sequence: 172 a.a.     [Download]
>gi|409249543|ref|YP_006885368.1| Major exported protein Secreted protein hcp [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRSHKPFIF
TVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLVYRKIEWEHVKSGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|409249475|ref|NT_187088.1|:71471-71989 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGCCAACACCGTGTTACATCTCAATTACGGGGCAAACCCAGGGCAATATCACCGCTGGTGCATTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGTCACGAGGATGAAATGCTGGTACAGGAATTCCTGCATAA
CGTGACCGTACCCACCGATCCACAGTCCGGGCAGCCGAGCGGCCAGCGTTCACACAAGCCGTTCATTTTT
ACCGTGGCGCTGAACAAAGCCGTGCCGCTGCTGTACAACGCGCTGGCGTCCGGTGAAATGCTGCCGAAAA
CCGAACTGCACTGGTGGCGTACTTCCGTTGAAGGCAAGCAGGAGCATTACTTCACCACCCGCCTGACGGA
CTCAACGATTGTGGATATGAAACTGCATATGCCGCACTGTCAGGACCCGGCAAAGCGCGAATTCACGCAG
TTGCTTGAAGTCTCGCTGGTCTACCGCAAAATCGAGTGGGAACACGTCAAATCCGGCACCTCTGGCGCGG
ATGACTGGCGCGCGCCGCTGGAAGCGTAA