SecReT6
Effector Protein ID: 410684623
sciK
SecReT6 ID784
T6SS typeA4b
Gene symbolsciK
Locus tagCMR15_mp10715
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]829463..829966 [+]
Productsecretion system protein (EvpC-like), Hemolysin-coregulated protein
Effector typeProtein
Homologous effectorRSp0745
DescriptionHcp protein
UniProt IDD8NHJ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.00E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|410684623|ref|YP_006060630.1| secretion system protein (EvpC-like), Hemolysin-coregulated protein [Ralstonia solanacearum CMR15]
MKDIYVKFDSPAIKGESQDKDHKEWIEVNSWSQSIIQPRSATASTAGGHTAERCEHRDMVFAKDLDVVSP
LLYQHVSGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVASEGIPTDTFSLRYAAVQWKYT
QQKSAGGQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|410683947|ref|NC_017589.1|:829463-829966 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGAAGGATATCTACGTCAAGTTCGACAGCCCGGCCATCAAGGGGGAGTCCCAGGACAAGGATCACAAGG
AGTGGATCGAAGTCAACAGCTGGTCCCAGTCGATCATCCAGCCGCGTTCGGCCACGGCCTCGACCGCGGG
CGGCCATACCGCCGAGCGTTGCGAACACCGCGACATGGTGTTCGCCAAGGACCTGGACGTGGTCAGCCCG
CTGCTGTATCAGCACGTTTCGGGCGGTACGACCTTCGGTGAAGTGACGATCGAGTTCTTCCGCGCCGACG
GCGAAGGCAACCGCGTGAAGTACCTCGAGGTCAAGCTGAAGAACGCGATCCTGAGCGAAGTGGATTCGCA
GGTGGCTTCCGAGGGTATCCCGACCGATACGTTCAGCCTGCGCTACGCGGCCGTGCAGTGGAAGTACACC
CAGCAGAAGAGCGCTGGCGGCCAGGGCGGCAACTCGCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTTTAA